KEGG   Palaeococcus pacificus: PAP_09030Help
Entry
PAP_09030         CDS       T03210                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ppac  Palaeococcus pacificus
Pathway
ppac00030  Pentose phosphate pathway
ppac01100  Metabolic pathways
ppac01120  Microbial metabolism in diverse environments
ppac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppac00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PAP_09030
Enzymes [BR:ppac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PAP_09030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AIF70186
UniProt: A0A075LVM4
LinkDB All DBs
Position
complement(1617095..1618912)
Genome map
AA seq 605 aa AA seqDB search
MYGYQGKILRVNLTTGKISEEKIDEEFAKKWLGTRGFGIHFLLKEIDPKVEPFSPENKLI
FATGPLTGTTAPTGGRYMVITKSPLTGYIAMANSGGFFGAELKFAGWDAIIFEGKAEHPV
YLYINDDQVELRDASHIWGKVVSETEKILTEEVGDKKVQIASIGPAGENLVRFAAVMNNG
HRAAGRGGVGAVMGSKNLKAVVVRGHKKVEIADRAKFMSVVKEKIEKLKNDPVAGGGLPK
YGTAVLVNIINQNGLYPTRNFQDSQFEYAEEQSGEALASKYLVKNKPCFACPIGCGRVTR
HPAVGVTEGPEYESTWALGAHLGINDLASIVIANHLCDEYGLDTISTGGTLATAMELYEK
GLIKPEELGDAPPLRFGNTEVLHYYIEKLTFREGFGDKLAEGGYRLAEMHNGVEYFMGVK
KQELPAYDPRGAEGHGLGYATNNRGGCHIKNYMISPEILGYPYKMDPHDISDDKVKMLIV
FQDLTAVIDAAGLCVFTTFGLGADDYRDMLNAALGWDLTTEEYLKIGERIWNAERLFNLK
AGLEPLKEDSLPKRLVGEPVKDGPNKGHVVRLKEMLPRYYSLRGWAGDGKIPEEKIKELG
LEEYV
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggataccaagggaaaattttgagggtaaatttgacaaccggaaagattagtgag
gaaaagattgatgaggagtttgcaaagaaatggcttgggacaaggggatttggcatacac
ttcctcttaaaggaaattgacccaaaagttgaacccttcagcccggagaataagcttata
tttgctacggggcctttaacaggaactactgccccaacaggcggaaggtatatggtaata
accaagagcccactgacgggttatattgctatggcaaactcaggtggcttttttggcgca
gaactcaagtttgccggatgggatgcaataatattcgaaggtaaagcagaacatcctgtt
tacctctacataaacgatgaccaagtcgagctgagagatgcatctcacatatggggtaag
gtcgtcagcgagactgaaaagatcctcacagaggaagttggagacaagaaagtgcagatt
gcatcaattggtcctgcgggtgagaatttagtacggtttgctgcggtgatgaacaacggc
cacagggctgcaggaagaggtggcgttggtgctgtaatgggatcaaagaatctaaaagct
gtggtcgttaggggccacaagaaagtggagatagcggatagggctaagttcatgagcgtt
gtaaaggagaagattgagaagcttaagaacgacccagttgctggtggaggattaccaaaa
tacggaacagctgttcttgtgaacattataaaccaaaacggcctctatccaacgaggaac
ttccaagacagccagtttgagtatgccgaggagcagagcggtgaggctttagcctcaaag
tacctagttaaaaacaaaccatgctttgcgtgcccaataggatgtggaagggtaacgagg
caccctgccgttggtgtaactgaaggaccagagtatgagagtacatgggctctcggtgca
cacctcggcataaacgatttggcgagcatagttatagcgaatcacctgtgtgatgaatac
ggccttgacactatatcgacgggtggaacattggcaacggctatggagctctatgagaag
ggtttaattaagccggaggagttgggagacgccccaccgctgaggtttggcaacaccgaa
gttctccactactacattgagaagctgacctttagagaaggctttggagataagctcgct
gagggaggctaccgcttagcggagatgcataacggcgttgagtacttcatgggggttaaa
aaacaggagctgccggcttatgacccgaggggtgcagagggtcatggtcttggttatgcc
acaaacaacagaggaggatgccacataaagaattatatgataagtccggagattttaggc
tacccctacaagatggatccccacgatataagtgacgacaaagtgaagatgctcatagtg
ttccaagacctaacagcggtaatagatgctgcaggtctgtgtgtatttactacatttggt
ctcggtgcggatgactacagagatatgctaaatgctgcccttggatgggacttaacaact
gaggaataccttaagattggagaaaggatatggaatgctgagaggctctttaacctcaaa
gcaggcttagaaccactcaaagaggacagcttaccaaagcgtctggttggagagcctgtg
aaggacgggccaaacaagggacatgttgtaaggctcaaagagatgctaccgaggtactac
tctctcagaggatgggcaggagacggaaagatacccgaggagaagattaaggagctcggc
ttagaggagtacgtttaa

DBGET integrated database retrieval system