KEGG   Panthera pardus (leopard): 109246902
Entry
109246902         CDS       T06062                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad01522  Endocrine resistance
ppad04068  FoxO signaling pathway
ppad04110  Cell cycle
ppad04115  p53 signaling pathway
ppad04151  PI3K-Akt signaling pathway
ppad04152  AMPK signaling pathway
ppad04218  Cellular senescence
ppad04310  Wnt signaling pathway
ppad04340  Hedgehog signaling pathway
ppad04371  Apelin signaling pathway
ppad04390  Hippo signaling pathway
ppad04510  Focal adhesion
ppad04530  Tight junction
ppad04630  JAK-STAT signaling pathway
ppad04917  Prolactin signaling pathway
ppad04919  Thyroid hormone signaling pathway
ppad04921  Oxytocin signaling pathway
ppad04933  AGE-RAGE signaling pathway in diabetic complications
ppad04934  Cushing syndrome
ppad05160  Hepatitis C
ppad05162  Measles
ppad05163  Human cytomegalovirus infection
ppad05165  Human papillomavirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05167  Kaposi sarcoma-associated herpesvirus infection
ppad05169  Epstein-Barr virus infection
ppad05200  Pathways in cancer
ppad05203  Viral carcinogenesis
ppad05205  Proteoglycans in cancer
ppad05206  MicroRNAs in cancer
ppad05210  Colorectal cancer
ppad05212  Pancreatic cancer
ppad05213  Endometrial cancer
ppad05214  Glioma
ppad05215  Prostate cancer
ppad05216  Thyroid cancer
ppad05218  Melanoma
ppad05219  Bladder cancer
ppad05220  Chronic myeloid leukemia
ppad05221  Acute myeloid leukemia
ppad05222  Small cell lung cancer
ppad05223  Non-small cell lung cancer
ppad05224  Breast cancer
ppad05225  Hepatocellular carcinoma
ppad05226  Gastric cancer
ppad05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109246902 (CCND1)
   04340 Hedgehog signaling pathway
    109246902 (CCND1)
   04390 Hippo signaling pathway
    109246902 (CCND1)
   04371 Apelin signaling pathway
    109246902 (CCND1)
   04630 JAK-STAT signaling pathway
    109246902 (CCND1)
   04068 FoxO signaling pathway
    109246902 (CCND1)
   04151 PI3K-Akt signaling pathway
    109246902 (CCND1)
   04152 AMPK signaling pathway
    109246902 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109246902 (CCND1)
   04115 p53 signaling pathway
    109246902 (CCND1)
   04218 Cellular senescence
    109246902 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109246902 (CCND1)
   04530 Tight junction
    109246902 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109246902 (CCND1)
   04921 Oxytocin signaling pathway
    109246902 (CCND1)
   04919 Thyroid hormone signaling pathway
    109246902 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109246902 (CCND1)
   05206 MicroRNAs in cancer
    109246902 (CCND1)
   05205 Proteoglycans in cancer
    109246902 (CCND1)
   05203 Viral carcinogenesis
    109246902 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109246902 (CCND1)
   05212 Pancreatic cancer
    109246902 (CCND1)
   05225 Hepatocellular carcinoma
    109246902 (CCND1)
   05226 Gastric cancer
    109246902 (CCND1)
   05214 Glioma
    109246902 (CCND1)
   05216 Thyroid cancer
    109246902 (CCND1)
   05221 Acute myeloid leukemia
    109246902 (CCND1)
   05220 Chronic myeloid leukemia
    109246902 (CCND1)
   05218 Melanoma
    109246902 (CCND1)
   05219 Bladder cancer
    109246902 (CCND1)
   05215 Prostate cancer
    109246902 (CCND1)
   05213 Endometrial cancer
    109246902 (CCND1)
   05224 Breast cancer
    109246902 (CCND1)
   05222 Small cell lung cancer
    109246902 (CCND1)
   05223 Non-small cell lung cancer
    109246902 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109246902 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109246902 (CCND1)
   04934 Cushing syndrome
    109246902 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109246902 (CCND1)
   05162 Measles
    109246902 (CCND1)
   05160 Hepatitis C
    109246902 (CCND1)
   05163 Human cytomegalovirus infection
    109246902 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109246902 (CCND1)
   05169 Epstein-Barr virus infection
    109246902 (CCND1)
   05165 Human papillomavirus infection
    109246902 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109246902 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 109246902
NCBI-ProteinID: XP_019270804
Ensembl: ENSPPRG00000024642
LinkDB
Position
Unknown
AA seq 295 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVLAAVQGLPLGSSNSFLSYPRLTRFLSKVIKCD
ADCLRACQEQIEALLESSLRQAQQQSLDPKAAEEEEEEEEADLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccaactcttatgctgcgaggtggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgtgaggagcagaagtgcgaggaagaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctccaagatgaaggagaccattccgctgacg
gccgagaagctgtgcatctacactgacaactccatccggcccgacgagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggccgcgatgaccccgcacgatttc
atcgagcacttcctctccaaaatgcccgtggccgaggagaacaaacagatcatccggaag
catgcgcagaccttcgtcgccctctgtgccacagacgtgaagttcatttccaacccgcct
tccatggtggcagcggggagcgtgctggccgcggtgcaaggcctgcccctgggaagctcc
aacagcttcctgtcctatccgcgcctcacccggttcctctccaaagtgatcaagtgcgac
gcggactgcctccgggcgtgccaggagcagatcgaggccctgctggagtccagcctgcgc
caggcccagcagcagagcctagaccccaaggcggcggaggaggaggaggaggaggaggag
gccgacctggcctgcacacccaccgacgttcgagacgtgaacatttga

DBGET integrated database retrieval system