KEGG   Panthera pardus (leopard): 109247848
Entry
109247848         CDS       T06062                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04014  Ras signaling pathway
ppad04390  Hippo signaling pathway
ppad04392  Hippo signaling pathway - multiple species
ppad05200  Pathways in cancer
ppad05206  MicroRNAs in cancer
ppad05219  Bladder cancer
ppad05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109247848 (RASSF1)
   04390 Hippo signaling pathway
    109247848 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    109247848 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109247848 (RASSF1)
   05206 MicroRNAs in cancer
    109247848 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    109247848 (RASSF1)
   05223 Non-small cell lung cancer
    109247848 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 109247848
NCBI-ProteinID: XP_019272477
Ensembl: ENSPPRG00000023663
LinkDB
Position
Unknown
AA seq 425 aa
MRGEKEKEGGDSARACPTPRPRRPIPPVGRHGRSAQVSFEPLVPVLSRRPAGIPGAAPNP
GPPRGPARPALARADSRRESGRDPAMSTKPELIELRELEPARRAGPGRTRLERANALRIA
PGTARNPARQLVAGRGHHFQPAGPATHTWCDLCGDFILGVVRKGLQCAHCKFTCHYRCRA
LISLDCCGPRDLGWEPALERDTNVDEPVEWETPDLSQAETEQKIKEYNSQINSNLFMSLN
KDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQAAQRGPGRGTAVRRRTSFYLPKDAVKHLH
VLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPS
EKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALH
ACPLG
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgcgtggagaaaaggaaaaggagggcggggactctgcgagagcatgcccaaccccgcgc
cctcgccgccccattccgcctgtgggccgacacggccggagcgcccaggtttcctttgaa
ccgctcgtccccgttctctcccgccgccctgccgggatcccgggggcggcgccgaatccg
ggtccgccccgcggccccgcccgccccgcgctcgctcgcgccgacagccggcgggagtcc
gggcgcgacccggccatgtccacgaaacctgagctcattgaactgagggaactggaaccc
gcgcggcgcgcgggccccggccgcacccggctggagcgtgccaacgcgctgcgcatcgcg
ccgggcaccgcgcgtaatccggcacggcagctggtcgcgggccgcggccaccacttccag
cccgcggggcctgccacacacacgtggtgcgacctctgcggcgacttcatcttgggcgtc
gtgcgcaagggcctgcagtgcgcgcattgcaagttcacctgccactaccgttgccgcgcg
ctcatcagcctggactgctgcgggccccgggacctgggctgggaacctgcgctggagcgg
gacaccaacgtggacgagcctgtggagtgggagacacctgacctttctcaggctgagact
gagcagaagatcaaggagtacaatagccagatcaacagcaacctcttcatgagcctgaac
aaggatggctcctacacaggcttcatcaaggttcaactgaagctggtgcgccctgtctcg
gtgccctccagcaagaagccaccctccttgcaggctgcccagcggggcccaggacggggc
acagctgtgaggcgccgcacctccttctacttgcccaaagatgccgtcaagcacctgcat
gtgttgtcacgcacacgggcacgcgaggtcattgaggccctactgcgcaagttcttagtg
gtggatgacccccgcaagtttgcactctttgagcgggctgaacgccatggccaagtgtac
ctccggaagctatcagatgatgagcaacccctgcggctgcggctccttgcagggcccagc
gagaaggccctaagctttgtcctcaaagagaatgactctggggaggtaaattgggatgcc
tttagcatgcctgagctacacaacttcttgcgcatcctgcagcgggaggaagaggaacac
ctccgccaaatcctgcaaaagtactcctattgccgtcagaagatccaggaggccctgcac
gcctgccccctggggtga

DBGET integrated database retrieval system