KEGG   Panthera pardus (leopard): 109249488Help
Entry
109249488         CDS       T06062                                 

Gene name
FOXQ1
Definition
(RefSeq) forkhead box protein Q1
  KO
K09410  forkhead box protein Q
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ppad03000]
    109249488 (FOXQ1)
Transcription factors [BR:ppad03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    109249488 (FOXQ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 109249488
NCBI-ProteinID: XP_019275464
Ensembl: ENSPPRG00000014349
LinkDB All DBs
Position
Unknown
AA seq 406 aa AA seqDB search
MKLEVFGPRAAHGDKPGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGSAEEL
AGGGERNAGCGPGAEEEVPAAVAAGHAEACAAGPGAGSAGGGEGARSKPYTRRPKPPYSY
IALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDP
SRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAAAPQPGLRPEEAAAHPAAAPPPPA
SAAPISPRARSPARHEGRASPAGKFSSSFAIDSILSKPFRSRRDGDAAPGARLPWGAAPC
PPLPTYPALLPEASGGALLPMCAYSAVEPLLLSARGADAPPAAPPAVPHLLLAPLSASAP
AKPFRGPAAGGGAHLYCPLRLPAALQASSAGGPGPHLPYPVETLLA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaagttggaggtgttcggcccccgcgcggcccacggggacaagccgggtagtgacttg
gagggtgccggcggcagcgacgcaccatctccgctgtccgcagccggcgacgattccctg
ggctcggacggggactgcgcggccaacagcccggcggcgggcggcagcgccgaggaactg
gcgggcggcggcgagcggaacgcaggctgcgggccaggcgctgaggaggaggtccccgca
gcggtggcggcggggcacgcggaggcctgcgcagccgggccaggtgcggggagcgcgggg
ggcggcgagggcgcgcgcagcaagccgtacacgcggcggcccaagcccccgtactcgtac
atcgcgctcatcgccatggctatccgcgactcggctggagggcgcctgacgctggccgaa
atcaacgagtacctcatgggcaagttccccttcttccgcggaagctacaccggctggcgc
aactccgtgcgccacaacctctcacttaacgactgcttcgtcaaggtgttgcgcgacccc
tcgcggccctggggcaaggacaactactggatgctcaaccccaacagcgagtacaccttc
gccgacggggtctttcgccgccgccgcaagcgcctcagccaccgggcggcagccccccaa
ccagggcttcggccagaggaggccgcggcccaccccgccgctgcgccccctccgcccgcg
tccgccgccccgatttctccccgtgcgcgctcgcccgcccgccacgaggggcgcgccagc
cctgcgggcaagttttccagttctttcgccatagacagcatcctaagcaagcccttccgc
agccgccgagatggggacgcagcccccggggcgcggctgccatggggcgccgcaccctgt
ccgccgctccccacatatcctgcgctcctccccgaagcctccggaggggccctgctgccg
atgtgcgcttacagtgcggtggagcccttgctgctgagcgcgcgcggagccgacgcaccg
ccggccgcgccacccgcagtgcctcacctcttgcttgcgcccctctctgcctcggccccc
gccaagccgtttcgtggccccgcggctggcggcggcgcgcacctgtactgccccctgcgg
ctgcccgcggcgctgcaggcgtcctcagccggtggccccggcccgcacctgccttaccca
gtggagacgcttctggcctga

DBGET integrated database retrieval system