KEGG   Panthera pardus (leopard): 109250815
Entry
109250815         CDS       T06062                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04060  Cytokine-cytokine receptor interaction
ppad04151  PI3K-Akt signaling pathway
ppad04210  Apoptosis
ppad04630  JAK-STAT signaling pathway
ppad04640  Hematopoietic cell lineage
ppad04664  Fc epsilon RI signaling pathway
ppad05200  Pathways in cancer
ppad05202  Transcriptional misregulation in cancer
ppad05221  Acute myeloid leukemia
ppad05310  Asthma
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109250815 (IL3)
   04151 PI3K-Akt signaling pathway
    109250815 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109250815 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109250815 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109250815 (IL3)
   04664 Fc epsilon RI signaling pathway
    109250815 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109250815 (IL3)
   05202 Transcriptional misregulation in cancer
    109250815 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109250815 (IL3)
  09163 Immune disease
   05310 Asthma
    109250815 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ppad04052]
    109250815 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:ppad00536]
    109250815 (IL3)
Cytokines and growth factors [BR:ppad04052]
 Cytokines
  Interleukins
   109250815 (IL3)
Glycosaminoglycan binding proteins [BR:ppad00536]
 Heparan sulfate / Haparin
  Cytokines
   109250815 (IL3)
SSDB
Motif
Pfam: IL3 DUF4089
Other DBs
NCBI-GeneID: 109250815
NCBI-ProteinID: XP_019277474
LinkDB
Position
Unknown
AA seq 143 aa
MSNLPIMYLLLLLLGFQAPQAQGRPFPTYQLNQYLAKIDEIMQILNKLPLPSQDPLDPNE
TETLRENTLLRPNLDAFLKAAENFHEDGLLIWKNLKEFLPLLPTPTPRGNPIHIEEDNWV
DFQRKLTKYLEILDNFLNFKEKH
NT seq 432 nt   +upstreamnt  +downstreamnt
atgagcaaccttcccatcatgtaccttctcctgcttcttcttggattccaagcccctcag
gcacaggggcggccctttccgacataccagctgaaccaatacttggcaaagattgatgaa
attatgcagatcttaaacaagttacccttgccttcacaggaccccttggacccaaatgag
acagagaccctgagggaaaacacccttctgaggccaaacctggatgcattcttaaaagct
gcagaaaatttccacgaagatggactgctaatctggaaaaatcttaaggaattcctgcca
ctcctgcccactcccacacccaggggaaacccaatccatatcgaggaggataactgggtt
gatttccaaaggaaactgactaaatatctggaaatccttgataactttctgaatttcaag
gagaaacactga

DBGET integrated database retrieval system