KEGG   Panthera pardus (leopard): 109250887
Entry
109250887         CDS       T06062                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04060  Cytokine-cytokine receptor interaction
ppad04151  PI3K-Akt signaling pathway
ppad04630  JAK-STAT signaling pathway
ppad04640  Hematopoietic cell lineage
ppad04657  IL-17 signaling pathway
ppad04658  Th1 and Th2 cell differentiation
ppad04659  Th17 cell differentiation
ppad04660  T cell receptor signaling pathway
ppad04664  Fc epsilon RI signaling pathway
ppad04672  Intestinal immune network for IgA production
ppad05140  Leishmaniasis
ppad05200  Pathways in cancer
ppad05310  Asthma
ppad05320  Autoimmune thyroid disease
ppad05321  Inflammatory bowel disease
ppad05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109250887 (IL4)
   04151 PI3K-Akt signaling pathway
    109250887 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109250887 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109250887 (IL4)
   04660 T cell receptor signaling pathway
    109250887 (IL4)
   04658 Th1 and Th2 cell differentiation
    109250887 (IL4)
   04659 Th17 cell differentiation
    109250887 (IL4)
   04657 IL-17 signaling pathway
    109250887 (IL4)
   04664 Fc epsilon RI signaling pathway
    109250887 (IL4)
   04672 Intestinal immune network for IgA production
    109250887 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109250887 (IL4)
  09163 Immune disease
   05310 Asthma
    109250887 (IL4)
   05320 Autoimmune thyroid disease
    109250887 (IL4)
   05321 Inflammatory bowel disease
    109250887 (IL4)
   05330 Allograft rejection
    109250887 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109250887 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ppad04052]
    109250887 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:ppad00536]
    109250887 (IL4)
Cytokines and growth factors [BR:ppad04052]
 Cytokines
  Interleukins
   109250887 (IL4)
Glycosaminoglycan binding proteins [BR:ppad00536]
 Heparan sulfate / Haparin
  Cytokines
   109250887 (IL4)
SSDB
Motif
Pfam: IL4 FAD_SOX
Other DBs
NCBI-GeneID: 109250887
NCBI-ProteinID: XP_019277590
LinkDB
Position
Unknown
AA seq 133 aa
MDLTSQLIPALVCLLAFTSTFVHGQNFNNTLKEIIKTLNILTARNDSCMELTVMDVLAAP
KNTSDKEIFCRATTVLRQIYTHHNCSTKFLKGLDRNLSSMANRTCSVNEVKKSTLKDFLE
RLKAIMQKKYSKQ
NT seq 402 nt   +upstreamnt  +downstreamnt
atggatctcacctcccaactgattccagctctggtctgcttactagcatttaccagcacc
ttcgtccacggccagaacttcaataatacgttgaaagagatcatcaaaacgttgaacatc
ctcacagcgagaaacgactcgtgcatggagctgactgtcatggacgtcttggcagcccca
aagaacacaagtgacaaggaaatcttctgcagagccacaaccgtgctccggcagatctat
acacaccacaactgctccaccaaattcctcaaaggactcgacaggaacctcagcagcatg
gcaaacaggacctgttctgtgaatgaagtcaagaagagtacactgaaagacttcttggaa
aggctaaaagcgatcatgcaaaagaaatactcaaagcaatga

DBGET integrated database retrieval system