KEGG   Panthera pardus (leopard): 109251316
Entry
109251316         CDS       T06062                                 

Gene name
EPO
Definition
(RefSeq) LOW QUALITY PROTEIN: erythropoietin
  KO
K05437  erythropoietin
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04060  Cytokine-cytokine receptor interaction
ppad04066  HIF-1 signaling pathway
ppad04151  PI3K-Akt signaling pathway
ppad04630  JAK-STAT signaling pathway
ppad04640  Hematopoietic cell lineage
ppad05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109251316 (EPO)
   04066 HIF-1 signaling pathway
    109251316 (EPO)
   04151 PI3K-Akt signaling pathway
    109251316 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109251316 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109251316 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109251316 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ppad04052]
    109251316 (EPO)
Cytokines and growth factors [BR:ppad04052]
 Cytokines
  CSF and other factors
   109251316 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 109251316
NCBI-ProteinID: XP_019278365
Ensembl: ENSPPRG00000007032
LinkDB
Position
Unknown
AA seq 205 aa
MCEPAPPXTHSAWHSFLECPALLLLLSLLLLPLGLPVLGAPPRLICDSRVLERYILEARE
AENVTMGCAEGCSFSENITVPDTKVNFYTWKRMDVGQQAVEVWQGLALLSEAILRGQALL
ANSSQPSETLQLHVDKAVSSLRSLTSLLRALGAQKEATSLPEATSAAPLRTFTVDTLCKL
FRIYSNFLRGKLTLYTGEACRRGDR
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtgtgaacctgctcctccannaacacactcagcctggcactcttttctagaatgtcct
gccctgctgcttctgctatctttgctgctgcttcccctgggcctcccagtcctgggcgcc
ccccctcgcctcatctgtgacagccgagtcctggagaggtacattctggaggccagggag
gccgaaaatgtcacgatgggctgtgctgaaggctgcagcttcagtgagaatatcactgtc
ccagacaccaaggtcaacttctatacctggaagaggatggacgtcgggcagcaggctgtg
gaagtctggcagggcctcgccctgctctcagaagccatcctgcggggccaggccctgctg
gccaactcctcccagccatctgagaccctgcagctgcatgtggataaagccgtcagcagc
ctgcgcagcctcacctccctgcttcgggcactgggagcccagaaggaagccacctccctt
ccagaggcaacctctgctgctccactccgaacattcactgtcgatactttgtgcaaactt
ttccgaatctactccaacttcctgcggggaaagctgacgctgtacacaggggaggcctgc
cgaagaggagacaggtga

DBGET integrated database retrieval system