KEGG   Panthera pardus (leopard): 109251365
Entry
109251365         CDS       T06062                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04010  MAPK signaling pathway
ppad04060  Cytokine-cytokine receptor interaction
ppad04068  FoxO signaling pathway
ppad04144  Endocytosis
ppad04218  Cellular senescence
ppad04350  TGF-beta signaling pathway
ppad04380  Osteoclast differentiation
ppad04390  Hippo signaling pathway
ppad04520  Adherens junction
ppad04659  Th17 cell differentiation
ppad04926  Relaxin signaling pathway
ppad04933  AGE-RAGE signaling pathway in diabetic complications
ppad05142  Chagas disease
ppad05161  Hepatitis B
ppad05166  Human T-cell leukemia virus 1 infection
ppad05200  Pathways in cancer
ppad05202  Transcriptional misregulation in cancer
ppad05210  Colorectal cancer
ppad05212  Pancreatic cancer
ppad05220  Chronic myeloid leukemia
ppad05225  Hepatocellular carcinoma
ppad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109251365 (TGFBR2)
   04350 TGF-beta signaling pathway
    109251365 (TGFBR2)
   04390 Hippo signaling pathway
    109251365 (TGFBR2)
   04068 FoxO signaling pathway
    109251365 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109251365 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109251365 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    109251365 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109251365 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109251365 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    109251365 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109251365 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109251365 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    109251365 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109251365 (TGFBR2)
   05212 Pancreatic cancer
    109251365 (TGFBR2)
   05225 Hepatocellular carcinoma
    109251365 (TGFBR2)
   05226 Gastric cancer
    109251365 (TGFBR2)
   05220 Chronic myeloid leukemia
    109251365 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109251365 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109251365 (TGFBR2)
   05161 Hepatitis B
    109251365 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109251365 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppad01001]
    109251365 (TGFBR2)
Enzymes [BR:ppad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109251365 (TGFBR2)
Protein kinases [BR:ppad01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   109251365 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 109251365
NCBI-ProteinID: XP_019278400
Ensembl: ENSPPRG00000003360
LinkDB
Position
Unknown
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVLKSVNNGMMVTDNNGIIKFPQLCKFCDVRSST
CDSQKSCLSNCSITSICERPHEVCLAVWRKNDENITLETLCHDPKVTYHGIALEDSASPK
CIMKEKKVLGETFFMCSCSTDECNDYIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAI
AVIIIFYCYRVHRQQKLSPSWETSKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRTLGSSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKEYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSD
LQHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctccggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttctgaagtccgttaacaatggcatgatggtcaccgac
aacaatggtatcatcaagtttccgcaattgtgcaaattttgtgatgtgagatcttccacc
tgtgacagccagaaatcctgcctgagcaactgcagcatcacgtctatctgcgagaggcca
cacgaagtctgtctggccgtctggagaaagaacgatgagaacataaccctagagacgctt
tgccatgaccccaaggttacctaccatggaattgctcttgaagactctgcttctcccaag
tgtattatgaaggaaaaaaaggtgttgggcgagactttctttatgtgttcctgcagcacc
gatgaatgcaatgactacatcatcttctcagaagaatacgccaccaacaaccctgacctg
ttgttggtcatattccaagtgacaggcgtcagcctcctgcccccgctggggatcgccata
gccgtcatcatcatcttctactgctaccgtgttcaccggcagcagaagctgagcccatcc
tgggagaccagcaagccgcgaaagctcatggagttcagcgagcacctcgccatcatcctg
gaagacgaccgctctgacatcagctctacctgcgccaacaacatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtggggaaaggccgcttcgccgaggtctacaag
gccaagctgaagcagaacacttctgaacagttcgagactgtggcggtcaagatcttccct
tacgaggagtacgcctcctggaagacggagaaggacattttctcagacatcaacctgaag
cacgagaacatactgcagttcctgacagccgaggagcgcaagacggagctggggaagcag
tactggctgatcacggccttccacgccaagggcaacctgcaggagtacctgacgcggcac
gtcatcagctgggaggacctgcgcacgctgggcagctccctcgcccggggcattgcccac
ctgcacagcgaccacaccctgtgcgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctcgtcaagaacgatctgacctgctgcctgtgtgactttgggctt
tccctgcgtctggacccgaccctgtctgtggatgacctggccaacagcgggcaggtggga
actgcaagatacatggctccagaagtcctagagtccaggatgaatttggagaatgttgaa
tcctttaagcagacggatgtctactccatggctctggtcctctgggaaatgacatctcgc
tgtaatgcggtgggagaggtgaaagagtacgagcctccatttggttccaaggtgcgggag
cacccctgtgttgagagcatgaaggacaatgtgctgagagaccgaggacgaccagaaatt
cccagctcctggctcaaccaccagggcatccagatggtgtgcgagactctgaccgagtgc
tgggaccatgacccggaggcccggctcacggcccagtgcgtggcggagcgcttcagtgac
ctgcagcacctggacaggctctcggggaggagctgctccgaggagaagattcccgaagat
ggctcgttgaacactaccaaatag

DBGET integrated database retrieval system