KEGG   Panthera pardus (leopard): 109251875
Entry
109251875         CDS       T06062                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00220  Arginine biosynthesis
ppad00330  Arginine and proline metabolism
ppad01100  Metabolic pathways
ppad04020  Calcium signaling pathway
ppad04066  HIF-1 signaling pathway
ppad04146  Peroxisome
ppad04371  Apelin signaling pathway
ppad04926  Relaxin signaling pathway
ppad05010  Alzheimer disease
ppad05014  Amyotrophic lateral sclerosis
ppad05022  Pathways of neurodegeneration - multiple diseases
ppad05133  Pertussis
ppad05140  Leishmaniasis
ppad05142  Chagas disease
ppad05145  Toxoplasmosis
ppad05146  Amoebiasis
ppad05152  Tuberculosis
ppad05200  Pathways in cancer
ppad05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    109251875 (NOS2)
   00330 Arginine and proline metabolism
    109251875 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109251875 (NOS2)
   04066 HIF-1 signaling pathway
    109251875 (NOS2)
   04020 Calcium signaling pathway
    109251875 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109251875 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    109251875 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109251875 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109251875 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109251875 (NOS2)
   05014 Amyotrophic lateral sclerosis
    109251875 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    109251875 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109251875 (NOS2)
   05152 Tuberculosis
    109251875 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109251875 (NOS2)
   05145 Toxoplasmosis
    109251875 (NOS2)
   05140 Leishmaniasis
    109251875 (NOS2)
   05142 Chagas disease
    109251875 (NOS2)
Enzymes [BR:ppad01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     109251875 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 109251875
NCBI-ProteinID: XP_019279369
Ensembl: ENSPPRG00000003356
LinkDB
Position
Unknown
AA seq 1157 aa
MACPWQFLFKAKSHQYNLTEETDINNNVGKAVWAPSGLVTQDDPKCHSLSKHRNEPPQSL
TGTVKTVPESLGKLDMPPSACPRHVRIKNWGSGMTFQDTLHHKAKGDLACRSKSCLGAIM
NPKSLTRGPRDKPTPPDELLPQAIEFVNQYYSSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYATNNGNI
RSAITVFPQRSDGKHDFRIWNAQLIRYAGYQMPDGTILGDPASVEFTQLCIDLGWKPKYG
RFDVVPLVLQADGGDPELFEIPPDLVLEVPMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVIEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFFYYQVEAWKTHIWQDEKRRPRRRKIPFKVLVQAVLFASMLMRKTMASRVRAT
ILFATETGKSETLARDLGALFSCAFNPKILCMDQYRLSNLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLAPTGEGD
ELSGQEEAFRSWAVQTFKAACETFDVRGKHRIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
NKALGSMHAKNVFTMRLKSQRNLQSAKSSRTTLLVELSCEDSHRLSYLPGEHLGVFPGNQ
LALVKGILERVVDGPAPHQPVHLETLSESGSYWVRDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLAQLATEEAERQRLEILCQPSEYNKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRYYSISSSRACAPTEVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCF
VRSAGGFQLPEDPSQPCILIGPGTGIAPFRSFWQQRLHDAEHKGLRGSRMTLVFGCRRPD
EDHLYREEMLEMAQKGVLHEVHTAYSRLPGQPKVYVQDILRQQLASEVLRVLHEEQGHLY
VCGDVRMARDVAQTLKHLLATKLSLSEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDG
AARQPSDPRVPAAHGTS
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagtttctgttcaaggccaaatcccaccagtacaacttgactgag
gaaacagacatcaacaacaatgtggggaaggccgtctgggccccctctggtctagtgaca
caggatgaccccaagtgtcacagcctcagcaaacaccggaatgagcccccccagtccctc
acggggacagtaaagacagttccagaatccctggggaagctggatatgcccccgtcggcc
tgcccacggcacgtgaggatcaaaaactggggcagtgggatgactttccaagacacactt
caccacaaggccaaaggggatcttgcttgcaggtctaagtcttgtctgggagccatcatg
aaccccaaaagtttgaccagaggacccagggacaagcctacccccccagacgagcttcta
cctcaagctatcgaatttgtcaaccagtattacagctccttcaaagaagcaaaaatagag
gaacatctggccagggtggaagcagtaacaaaggagatagaaacaacaggaacctatcag
ctgacgggagatgagctcatcttcgccaccaagcaggcttggcgcaatgccccccgctgc
atcgggaggatccagtggtccaacctacaggtcttcgatgcccggagctgttccactgcc
caggaaatgtttgagcacatctgcagacacgtgcgttatgctaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagtgatgggaagcatgacttccggatctgg
aacgctcagctcatccggtatgctggctaccagatgcctgatggcaccatcctgggggac
cctgccagcgtggagttcacccagctgtgcatcgacctgggctggaagcccaagtacggc
cgctttgatgtggtgcctctggtcctgcaggctgatggcggagaccctgagctctttgaa
atcccgcctgacctcgtgctcgaggtgcccatggaacatcccaagtatgagtggttccgt
gaactggagctaaagtggtatgccctgcctgccgtggccaacatgctgctcgaggtgggt
ggcctggagttcccagggtgccccttcaatggctggtacatgggcacggagatcggggtc
cgggacttctgtgacgttcagcgctacaacatcctggaggaagtgggcagaaggatgggc
ctggaaacacacaaactggcctcactctggaaggaccgggctgtcattgagatcaacgtc
gccgtgctgcacagtttccagaagcaaaacgtgaccatcatggaccaccactcggctgcg
gagtccttcatgaagtacatgcagaacgagtaccggtcccgagggggctgtcctgccgac
tggatttggctggtgcccccaatttctggcagcatcactcccgtgttccaccaggagatg
ttaaactatgtcctgtcccctttcttctactaccaggtggaggcctggaaaacccacatc
tggcaggatgagaagcggagaccccggagaagaaagattccgttcaaagtcttggttcaa
gctgtgctcttcgcctccatgctgatgcgcaagaccatggcgtcccgagtgagagccaca
atcctctttgcgacggagacaggaaagtcagaaacactggcccgggacctaggggccttg
ttcagctgtgccttcaaccccaagattctctgcatggaccagtacaggctgagcaacctg
gaggaagagcagctactactggtggtgaccagcacgtttgggaacggagactcccccggc
aacggagagaaactgaaaaaatccctcttcatgctgaaagagcttaccaacaagttcagg
tatgccgtgttcggcctcggctccagtatgtaccctcggttctgtgcctttgctcatgac
atcgaccagaagctgtcccatctgggggcctctcagcttgccccaacaggggaaggggac
gagctcagtggacaggaggaagccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacgttcgatgtgcgaggcaagcaccgcattcagatccccaagctctacacctcc
aatgtgacctgggacccgcaccactacaggctcgtgcaggactcacagcctctggacctc
aacaaagctctcggcagtatgcacgccaagaacgtgttcaccatgaggctcaaatcacag
cggaatctccagagtgcgaaatccagccgcaccaccctcctggtggagctctcctgtgag
gacagccaccggctgagctacctgcctggagagcacctcggggttttcccaggcaaccag
ctggctctggtaaaaggcatcttggagcgagtggtggacggccctgcaccccaccaaccg
gtgcacctggagaccctcagcgagagcggaagctactgggtcagagacaagcggctgccc
ccgtgctcgctcagccaggccctcacctacttcctggatatcaccacccccccaacccag
ctgctgctccgcaaattggcacagctggccacagaagaggcagagaggcagaggctggag
atcctgtgccagccctcagagtacaacaaatggaagttcaccaatagccccacattcctg
gaggtactggaggagttcccatccctgcgggtgtctgctggcttcctgctctcccagctg
cctattctgaaaccccggtactactccatcagctcctccagggcctgtgcacccacggag
gtccacctcactgtggctgtgctcacctaccgcacccgagatggccaaggtcccttgcac
cacggcgtctgcagcacatggctcagcagcctgaagccccaagacccagtaccctgcttt
gtgagaagtgccggcggcttccagctccctgaggacccttcccaaccttgcatcctcatt
gggcctggcacaggcatcgcccccttccgcagcttctggcagcagcggctccatgatgcc
gagcacaaagggctccggggcagccgcatgaccctggtgttcgggtgccgccgcccggat
gaggaccacctctatcgggaggagatgttggagatggcccagaagggggtgctgcatgag
gttcacacagcctactctcgcctgcctggccagcccaaggtctatgttcaagacatcctg
aggcagcagctggccagcgaggtgctccgtgtgctccatgaggagcaaggccacctttat
gtctgtggggatgtgcgtatggcccgggatgtggcccaaaccctgaagcacctcctggcc
accaagctgagcctgagcgaggagcaggtggaggactatttcttccaacttaagagccag
aagcgctatcatgaagacatctttggtgctgtatttccctacgaggtgaaaaaggatggg
gcagcaaggcagcccagcgatcccagagttccagcggcccacgggacaagttaa

DBGET integrated database retrieval system