KEGG   Panthera pardus (leopard): 109252228
Entry
109252228         CDS       T06062                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04010  MAPK signaling pathway
ppad04014  Ras signaling pathway
ppad04015  Rap1 signaling pathway
ppad04151  PI3K-Akt signaling pathway
ppad04390  Hippo signaling pathway
ppad04810  Regulation of actin cytoskeleton
ppad05200  Pathways in cancer
ppad05218  Melanoma
ppad05224  Breast cancer
ppad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109252228 (FGF1)
   04014 Ras signaling pathway
    109252228 (FGF1)
   04015 Rap1 signaling pathway
    109252228 (FGF1)
   04390 Hippo signaling pathway
    109252228 (FGF1)
   04151 PI3K-Akt signaling pathway
    109252228 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109252228 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109252228 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    109252228 (FGF1)
   05218 Melanoma
    109252228 (FGF1)
   05224 Breast cancer
    109252228 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ppad04052]
    109252228 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:ppad00536]
    109252228 (FGF1)
Cytokines and growth factors [BR:ppad04052]
 Growth factors
  Growth factors (RTK binding)
   109252228 (FGF1)
Glycosaminoglycan binding proteins [BR:ppad00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   109252228 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 109252228
NCBI-ProteinID: XP_019280097
Ensembl: ENSPPRG00000006650
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacaaccttcacggccctgacggagaagttcaatctgcctcca
gggaattacaagaaacccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggatgggacgagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttgtacggctcacagacaccaaatgaggaatgcttgttc
ctggaaaggctggaagaaaaccattacaacacctacacatccaagaagcacgcagaaaag
aattggtttgtgggtctcaagaagaatggaagctgcaaacgcggtccccggactcactat
ggccagaaggcaattttgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system