KEGG   Panthera pardus (leopard): 109252236
Entry
109252236         CDS       T06062                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109252236 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ppad03000]
    109252236 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ppad03310]
    109252236 (NR3C1)
Transcription factors [BR:ppad03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    109252236 (NR3C1)
Nuclear receptors [BR:ppad03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   109252236 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 109252236
NCBI-ProteinID: XP_019280113
Ensembl: ENSPPRG00000002713
LinkDB
Position
Unknown
AA seq 782 aa
MDSKESLSPPSKEEISSSVLGRERGNVMDFYKTLRGGASVKVSASSPSLAAVAQSDSKQQ
RLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNELGFPQQGQISLSSGETDF
QLLEESIANLNRSTSVTENPKSSATVAVAAAPTEKEFPKTLSDVSSEQQNLKGHTGTNGG
NVKLYTTDQSTFDIWRKKLQDLEFSSGSPDKETSESPWRSDLLIDENCLLSPLAGEDDPF
LLEGNSNEDCKPLVLPDTKPKIKDNGDLIVSSPNSVSLPQVKTEKEDFIELCTPGVIKQE
KLGPVYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIP
PITVGSENWNRCQASGDDNLASLGTLNFPGRSVFSNGYSSPGMRPDVSSPPSSSAAATGP
PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPA
CRYRKCLQAGMNLEARKTKKKIKGIQQATPGVSQETSENPANKTVVPATLPQLTPTLVSL
LEVIEPEVLYAGYDSSMPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTL
LQYSWMFLMAFALGWRSYRQSSANMLCFAPDLVINEHRMTLPCMYEQCKHMLFVSSELHR
LQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRF
YQLTKLLDSMHDVVENLLNFCFQTFLNKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFH
QK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggactccaaggaatcattaagcccccccagtaaagaagaaatctctagcagtgtgctt
ggtcgggagaggggaaatgtgatggacttctataaaaccctaaggggaggagcttctgtg
aaggtttctgcatcttcaccgtcactggctgctgttgctcagtcagactccaagcagcaa
agacttttggtggattttccaaaaggctcaggaagcaatgcacagcagccggatctgtcc
aaggcagtttcgctctcaatgggactgtatatgggagagacagaaacaaaagtaatggga
aatgagctgggattcccacagcagggccaaatcagcctttcctctggggaaacagacttt
cagcttctggaagaaagcatcgcaaacctcaataggtcgaccagtgttaccgagaacccc
aagagctcagcaaccgttgctgttgctgctgcccccacagagaaggagtttccaaaaaca
ctctctgatgtctcttcagaacagcaaaatttgaagggccatactggcaccaacgggggc
aatgtgaagttgtataccacagaccaaagcacctttgacatttggaggaaaaaactccag
gatttggaattttcttctgggtccccagataaagagacaagtgagagtccttggagatca
gacctcttgatagatgaaaactgtttgctttctcctttggcaggagaggatgatccattc
cttttggaaggaaactcgaatgaggactgtaagcctcttgttttaccggacactaaacct
aaaattaaggataatggagatctgatcgtatcaagccccaacagtgtgtcactgccccaa
gtgaaaacagaaaaagaagatttcattgaactctgcacccctggggtaattaagcaggag
aaactgggcccagtttattgtcaggcaagcttttctggggcaaatataattggtaataaa
atgtctgccatttctgttcatggcgtgagtacctctgggggccagatgtaccactatgac
atgaatacagcatccctttcgcaacaacaggatcagaagcctattttcaatgtcattcca
ccaattactgttggttcagaaaattggaataggtgtcaagcatctggagatgacaacttg
gcttccttggggactttgaacttccctggccgatcggtgttttctaatggctattcaagc
cctggaatgagaccagatgtaagctctcctccatccagctctgcagcggcaacgggacca
cctcccaaactctgccttgtgtgctctgatgaagcttcggggtgtcactacggggtcttg
acatgtggaagctgtaaagtattcttcaaaagagcagtggaaggtagacagcacaattat
ctttgtgctggaagaaatgattgtatcattgataagattcgaagaaaaaactgtccagca
tgccgctatcgaaaatgtctccaggctggaatgaacctggaagctcgaaaaacaaagaaa
aagataaaaggaattcagcaggccaccccaggagtgtcccaagaaacttctgaaaaccct
gctaacaaaacggtagttcctgcaacattaccacagctcacccctaccctggtgtccctg
ctggaggtcatcgaacccgaggtgttatacgcagggtatgatagctcaatgccagattcg
acttggcggatcatgaccacactcaacatgttaggcgggaggcaagtgattgcagcagtg
aaatgggccaaggcgataccaggattcaggaacttacacctggatgaccaaatgacccta
ctgcaatattcatggatgttcctcatggcatttgccctggggtggagatcatatagacaa
tcaagtgcgaacatgctgtgttttgctcctgatctggttattaatgagcatagaatgact
ctaccctgcatgtatgaacaatgtaaacatatgctgtttgtttcctctgagttacacagg
cttcaggtatcttatgaagagtatctctgtatgaaaaccttactgcttctctcttcagtt
cctaaggaaggtttgaagagccaagagctatttgatgaaattagaatgacctacatcaaa
gagctaggaaaagccattgtcaagagggaaggaaactccagtcagaactggcagcggttt
tatcaactgacaaaactcttggactccatgcatgatgtggttgaaaatctccttaacttt
tgcttccaaacatttttgaataagaccatgagtattgaattcccagagatgttagctgaa
atcatcaccaatcagataccaaaatattcaagtggaaatatcaaaaaacttctgtttcat
caaaagtga

DBGET integrated database retrieval system