KEGG   Panthera pardus (leopard): 109254156
Entry
109254156         CDS       T06062                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04010  MAPK signaling pathway
ppad04020  Calcium signaling pathway
ppad04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109254156 (CACNA1E)
   04020 Calcium signaling pathway
    109254156 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109254156 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ppad04040]
    109254156 (CACNA1E)
Ion channels [BR:ppad04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109254156 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 109254156
NCBI-ProteinID: XP_019283384
Ensembl: ENSPPRG00000000086
LinkDB
Position
Unknown
AA seq 2459 aa
MVPEMRGPSPGRRLPEPAPCPAAGGNPEPWALGRRHRHVLALPEEEAWRPQQCALLEADA
SDEVGMLPASPRAVAAGFDNFFPVQEGEGPGWEGGAALEAGSSPFLPVSPEVMKRRRGGL
IEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGDGDSDQSRNRQGTPVPAS
GPAAAYKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEY
MILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKG
SYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKS
IMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFTNSSGILEGFDPPHPCGVQGC
PAGYECKDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIP
LIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEV
MLAEENKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVD
GASYFRHKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEF
LFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRA
LRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFND
GTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYT
LLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRR
HHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNP
LSPLNPLNAHPSLYRRPRPIEGLGLGLEKCEEERISRGGSLKGDGGDLPSALDNQRSPLS
LGKREPPWLARPCHGNCDSTQQEAGGGETVVTFEDRARHRQSQRRSRHRRVRTEGKEPSS
TSRSRSASQERSLDEGVPTEGEKDREPRASHGGKEPTIQEEERGQDLRRTNSLMVPRGSG
LAGALDEANTPLVQPQPELEMGKDTALTEQEPEGSSEQALLGDVQLDMGRAISQSEPDLS
CVTANTDKATTESTSVTVAIPDVGPLVDSTVVHISNKTDGEASPLKEAEIKEEEEEVEKK
QQKKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAED
PVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGAL
VAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILI
VYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFH
YDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFF
VNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHF
VVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGF
LNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIR
ILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLM
LLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLM
LNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPP
LGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSE
LQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQK
NAPMFQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDP
ADDGQFQEQQSLEPEVSELKSVQSSNHGIYLPSDTQEHTGSGRASSMPRLTVDPQVVTDP
SSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSD
THRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERHESRSPSEGRSQTPNRQG
TGSLSESSIPSISDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHTGSMSPPADGSEGGSP
LASQALESPEAGLAESSSSRHVQQGQHASPQRYISEPYLALHEDSHASDCGEEETLTFEA
AVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGVMCGAVSDLLSDTEEDDKC
NT seq 7380 nt   +upstreamnt  +downstreamnt
atggtgccagagatgcgtggaccgagcccaggccgcaggctgcccgagcccgccccctgc
cccgccgcaggcgggaaccctgagccctgggccttgggccgccgccaccgccacgtccta
gccctgcctgaggaggaggcatggcggccccagcagtgcgccctgctcgaggccgacgcc
tcggacgaggtgggcatgctgcccgcctccccgcgtgccgtcgccgcgggcttcgacaac
ttcttcccggtgcaggagggcgagggccccggctgggagggcggcgcggccctggaagct
ggctccagcccgttcctcccggtgagccccgaggtgatgaagcggcggcgcggggggctc
atcgagcagcgcgacatcatcaaggcccacgaggcgcacaagatgcagagcaccccgcag
gcccggcgcaaggagtgggagatggctcgcttcggggaggcggtggtcggcaggccgggg
tcgggcgatggagactcggaccagagcaggaaccggcaaggaaccccggtgccggcctcg
gggccagcggccgcctacaagcagtcgaaagcgcagagggcgcggactatggctttgtac
aaccccattcccgtccggcagaactgtttcaccgtcaacagatccctgttcatcttcgga
gaagataatattgtcaggaaatacgccaagaagctcatcgattggccgccgtttgagtac
atgattttggccaccatcattgccaactgcattgtcttggccctggaacagcatcttcct
gaggatgacaagaccccaatgtcccgcagactggagaagacagaaccatatttcattggg
atcttttgctttgaagctggtatcaaaattgtggccctggggttcatcttccataagggc
tcgtacctccgcaatggctggaatgtcatggatttcatcgtggtcctcagtggcatcctg
gctacggcaggaacccacttcaacacacatgtggacctgaggacccttcgggctgtgcgt
gtcctgaggcccctgaagctcgtgtcagggatacctagcctacagattgtgttgaagtcc
atcatgaaggccatggtgcctcttctgcaaattggccttctgctcttctttgccatcttg
atgttcgccatcattggcttggagttctacagtgggaagttgcaccgggcatgtttcacg
aacagttcaggtattctggaaggatttgaccctcctcacccatgtggtgtgcagggctgc
ccagctggttatgaatgcaaggactggattggccccaacgatgggatcacccagtttgat
aacatcctttttgctgtgctgactgtcttccaatgcatcaccatggaaggatggaccacc
gtgctgtacaataccaatgatgccttaggagccacctggaattggctgtacttcatcccc
ctcatcatcattggatccttctttgttctcaacctcgttctgggagtgctttccggggaa
tttgccaaagagagagagagagtggagaaccggagagctttcatgaaattgcggcggcag
cagcagattgagcgtgagctgaatgggtaccgcgcctggatagacaaagcagaggaagtc
atgcttgctgaagaaaataaaaacgctggaacatcagccttagaagtgcttcgaagggca
accatcaaaaggagccggacagaggccatgactcgagactccagcgatgagcactgtgtt
gatatctcctctgtgggcacacctcttgcccgagccagcatcaaaagtgcaaaggtggat
ggggcctcctatttccggcacaaagaaaggcttctgcgcatctctatccgccacatggtc
aaatcccaggtgttttactggattgtgttgagccttgtggctctcaacactgcctgtgtg
gccatcgtccatcataaccagccccagtggctcacccatctcctctactatgcagaattt
ctgtttctgggactgttcctcttggagatgtccttgaagatgtatggcatggggcctcga
ctttactttcactcttcattcaactgttttgattttggggtcacagtgggcagtatcttt
gaagtggtctgggcaatcttcagacctggtacatcttttggaatcagtgtcttgcgagct
ctccggcttctaagaatatttaaaataaccaagtattgggcatctctgcgaaatctggtg
gtctccttgatgagttctatgaagtctatcatcagtttgctcttcctcctcttcctcttc
atcgttgtctttgctctcctaggaatgcagctgtttggcggcaggtttaactttaatgat
gggactccttcagcaaactttgacacctttccggcagccatcatgactgtattccagatc
ctaacaggtgaggactggaatgaggttatgtacaatgggatccgctcccagggtggagtt
agctcaggcatgtggtcagctatctatttcattgtgctcaccttgtttggaaactacaca
ctgctgaatgtgttcttggccattgctgtagacaatctggccaatgcccaagagctgacc
aaggatgaacaagaagaagaggaggccttcaaccagaaacatgcgttgcagaaggccaag
gaggtcagcccgatgtctgcacccaacatgccttctatcgaaagagacagaaggagaaga
caccacatgtcgatgtgggagccacgcagcagccacctgagggagcggaggcgccggcac
cacatgtcagtgtgggagcagcgcaccagccagctgagaaggcacatgcagatgtctagc
caggaggccctcaacaaagaggaggccccaccaatgaaccccctcaaccccctcaacccg
ctgagccccctcaacccactcaacgcccacccgagcctctaccggagacccagacccatt
gagggcctgggcctgggcctggagaaatgtgaggaggagcgcattagccgcggggggtcc
ctcaagggggacggaggggacctgccgagtgccttggacaaccagaggagccccttgtcc
ttgggcaaacgggagccaccatggctggccaggccgtgtcatgggaactgtgattcgacc
cagcaggaggctgggggaggggagactgtggtgaccttcgaggaccgggccaggcacagg
cagagccagcggcgcagcaggcaccgtcgtgtcaggaccgaaggcaaggaaccctcctcc
acctcccggagcaggtctgccagccaggagcggagtctggatgaaggggtgcccaccgag
ggggagaaggaccgcgagcccagggccagccacgggggcaaggaacccacaatccaggaa
gaggaaagaggccaagacttaaggaggaccaacagtctgatggtgcccagaggctctggg
ctggcaggagcccttgatgaggccaacacgcccttagtccagccgcagccagagttggaa
atggggaaggacacggctctgacagagcaggagccggagggcagcagtgagcaagctctg
ctgggggatgtgcagttggacatgggccgggccatcagtcagagtgagcccgacctctcc
tgtgtcacggccaacacggacaaggccaccactgagagtaccagcgtcaccgtcgccatc
cccgacgtgggccccttggtggactcaactgtggttcacatcagcaacaagactgatgga
gaagccagtcctttgaaggaggcagagatcaaagaggaagaggaagaggtagagaagaag
cagcaaaagaaggagaagcgtgagacgggcaaagccatggttccccacagctctatgttc
atcttcagcaccaccaacccgattcgcagggcctgccactacattgtgaacctgcgctac
tttgagatgtgcattctcctggtgattgcagccagcagcattgccctggcagccgaggac
cctgtcctgaccaactcggagcgcaacaaagtcctgaggtattttgactatgttttcact
ggcgtgttcacctttgagatggttataaagatgatagaccagggcttgatcctgcaggat
gggtcctacttccgagacctatggaacatcctggactttgtggtggtggttggcgcattg
gtggcctttgctttggcgaatgccttgggaactaacaaggggcgggacatcaagaccatc
aaatctctgagggtgctccgagttctgaggccgctgaagaccatcaagcgcttgcccaag
ctcaaggctgtctttgactgcgtggtgacttccttgaagaatgtcttcaacatactcatt
gtctacaagctcttcatgttcatcttcgctgtcatcgcagttcagctcttcaagggaaag
ttcttttattgcacggacagttccaaggacacagagaaggagtgcataggcaattatgta
gatcatgaaaaaaacaagatggaggtgaaaggccgggaatggaagcgccatgaattccac
tacgacaacattatctgggccctgctgaccctcttcactgtctccacaggggaaggatgg
cctcaagtcttacagcattctgttgatgtgacagaggaagaccgaggaccaagccgcagc
aaccgcatggagatgtccatcttttacgtggtctactttgtggtcttccctttcttcttt
gtcaatatctttgtggctctcatcatcatcaccttccaggagcaaggagacaagatgatg
gaggagtgcagcctggagaagaacgagagggcgtgcatcgacttcgccatcagtgccaaa
cctctcacccgctacatgccgcagaacaggcataccttccagtaccgcgtctggcacttc
gtggtgtcgccgtcctttgagtacaccattatggccatgatcgccttgaacaccgtcgtg
ctgatgatgaagtactactctgctccctgtacctatgaactggccctgaagtacctgaat
attgccttcaccatggtgttttctctggaatgtgtcctaaagatcatcgcgtttggcttc
ttgaactattttcgagatacctggaatatctttgactttatcaccgtgattggcagtatc
acagaaatcattctgacagacagcaagctggtgaacaccagtggcttcaatatgagcttt
ctgaagctcttccgagctgctcgtctcatcaagcttctacgtcagggctacaccatccgt
attttactttggacttttgtacagtcctttaaggccctcccctacgtctgccttttgatt
gccatgcttttcttcatctatgccatcatcgggatgcaggtatttggaaacataaaatta
gatgaggagagtcacatcaaccgacacaacaacttccggagtttcttcgggtccctcatg
ttactcttcaggagtgccacaggtgaggcctggcaggagataatgctgtcgtgcctcggg
gagaaaggctgtgagcccgacaccactgcgccatcagggcagaatgagaatgagcgctgt
ggcaccgatctggcctatgtttactttgtctccttcatcttcttctgctccttcttgatg
ctcaacctgtttgtggccgtcatcatggacaactttgagtacctgactcgggactcatcc
atcctagggcctcaccacttggacgagtttgtccgcgtctgggcagaatatgacagagct
gcatgtggccgcatccattacactgagatgtatgaaatgctgactctcatgtcaccaccg
ctaggcctcggcaagagatgtccctccaaagtggcatataagaggttggtcctgatgaat
atgccagtagctgaggacatgacagtccacttcacctccacactcatggctctgatacgg
acagcactggacatcaaaatcgccaaaggtggtgcagacagacaacagctagactcagaa
ctacaaaaggagaccctggccatctggcctcacctatcccagaagatgctggatctgctc
gtgcccatgcccaaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatc
atggactactacaaacagagtaaggtgaagaagcagaggcagcagctggaggaacagaaa
aacgcacccatgttccagcgcatggagccttcatctctgcctcaggagatcattgctaat
gccaaagccctgccttatctccagcaggaccctgtctcaggcttgagtggccgtagtgga
tacccttcgatgagtccgctctccccccaggaaatattccagttggcttgtatggaccca
gccgatgatggacagtttcaggaacagcagtctctggagccagaggttagtgaattaaaa
agcgtgcagtcctctaaccatggcatctaccttccttcggacacccaggagcatacggga
tctgggagggcatcctctatgccacgcctgactgtggatccccaggtggtgacagaccct
agctccatgagacgctcattttctaccattcgggataagcgttcaaattcctcatggttg
gaggaattctctatggagagaagcagtgaaaacacctacaagtcacgtcgccggagttac
cactcctccctgagactgtcagctcatcgcctgaattctgactcaggccacaagtctgac
acccaccgctcagggggcagagagcggggacggtcaaaagagcgaaagcatcttctctct
cccgatgtctcccgctgcaactcagaggagcgagggacccaggctgactgggagtccccc
gagcgccatgagtccaggtctcccagcgagggcaggtcacagacccccaacagacagggc
acgggttccctgagtgagagctccatcccctccatctctgacaccagcactccgagacga
agtcgccggcagctcccgcccgtgccaccaaagcctcggcccctcctttcctacagctcc
ctgattcgacacaccgggagcatgtctccaccggctgatggaagcgagggtggctctcct
ctggcctcccaagccctggagagccctgaggccggcctggcagagtcttccagctcccgg
cacgtacagcagggtcagcacgcctccccacagcgctacatctccgagccctacctggcc
ctgcatgaagactcccacgcctcggactgtggcgaggaggagacgctcaccttcgaagca
gctgtggccaccagcctgggccgctccaacaccattggctcggccccaccgctgcggcac
agctggcagatgcccaatgggcactatcgacggcggaggcgcggggggcccgggccaggt
gtgatgtgtggggctgtcagcgacctcctgagtgacacggaagaggacgacaagtgctag

DBGET integrated database retrieval system