KEGG   Panthera pardus (leopard): 109255362Help
Entry
109255362         CDS       T06062                                 

Gene name
HTR1F
Definition
(RefSeq) 5-hydroxytryptamine receptor 1F
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04024  cAMP signaling pathway
ppad04080  Neuroactive ligand-receptor interaction
ppad04726  Serotonergic synapse
ppad04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    109255362 (HTR1F)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109255362 (HTR1F)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    109255362 (HTR1F)
  09157 Sensory system
   04742 Taste transduction
    109255362 (HTR1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ppad04030]
    109255362 (HTR1F)
G protein-coupled receptors [BR:ppad04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    109255362 (HTR1F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 109255362
NCBI-ProteinID: XP_019285517
Ensembl: ENSPPRG00000011399
LinkDB All DBs
Position
Unknown
AA seq 366 aa AA seqDB search
MDSLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD
RYRAITDAVEYSRKRTPKHAGITITIVWIISIFISMPPLFWRHQGTSRDDECIIKHDHIV
STIYSTFGAFYIPLTLILILYYKIYKAAKMLYHKRQASRIAKEEVNGQVLLGSSEKSTRL
VSTPYMLEKSLSDPSTDFDKIHSTVKSSRSDFKHEKSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNVCEKCKISEEMSNFLTWLGYLNSLINPLIYTIFNEDFKKAFQK
LVRCRC
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggattccttaaactcatctgatcaaaacttgacttcagaagaactattaaacagaatg
ccgtctaaaattctggtgtccctcactctctccgggctggcactgatgacaacaaccatc
aactcccttgtgattgctgcaattattgtcacccggaagctgcaccacccagccaactat
ttaatttgctcccttgccgtcacagattttcttgtagctgtcctggtgatgcctttcagc
atcgtgtacattgtgagagagagctggattatggggcaggtggtctgtgacatctggctg
agtgttgacattacgtgctgcacgtgctccatcttgcatctctctgctatagctctggat
cggtatcgggcaatcacagatgctgtggagtactccaggaaaaggactcccaagcatgct
ggcattacgattacaatagtttggattatatctatttttatctctatgcctcctttattc
tggaggcaccaaggaactagccgcgatgatgagtgcatcatcaaacacgaccacatcgtc
tcgactatttactcaacattcggagctttctacatcccattaacattgattttgatcctc
tactacaaaatatataaagcagcgaaaatgttataccacaagagacaagcaagtaggatt
gccaaggaggaggtgaatggccaagtccttttggggagtagtgagaaaagcaccagacta
gtctccacaccctacatgctagaaaaatctttatctgatccatcaacagactttgataaa
attcacagcacagtgaaaagctccaggtctgatttcaagcatgagaaatcttggagaagg
caaaagatctcaggcacaagagaacgcaaagcagccactacgctggggttaatcttgggt
gcatttgtaatatgttggcttcctttctttgtaaaagaattggttgttaatgtctgtgaa
aagtgtaaaatttctgaagaaatgtcaaattttttgacatggcttggatatctcaactcc
cttataaatccactgatttatacaatctttaatgaagacttcaagaaagccttccaaaaa
cttgtacgatgtcgatgttag

DBGET integrated database retrieval system