KEGG   Panthera pardus (leopard): 109256147
Entry
109256147         CDS       T06062                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04060  Cytokine-cytokine receptor interaction
ppad04151  PI3K-Akt signaling pathway
ppad04210  Apoptosis
ppad04630  JAK-STAT signaling pathway
ppad04640  Hematopoietic cell lineage
ppad05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109256147 (IL3RA)
   04151 PI3K-Akt signaling pathway
    109256147 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109256147 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109256147 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109256147 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109256147 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ppad04050]
    109256147 (IL3RA)
   04090 CD molecules [BR:ppad04090]
    109256147 (IL3RA)
Cytokine receptors [BR:ppad04050]
 Interleukin receptor families
  IL3 receptor family
   109256147 (IL3RA)
CD molecules [BR:ppad04090]
 Proteins
  109256147 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 109256147
NCBI-ProteinID: XP_019286670
LinkDB
Position
Unknown
AA seq 453 aa
MAFLWLALCLTPACCLLHKDEDPESPIKNLRMQPETRRLTWDLSGNVSEIGCFINSRFIT
KATDKRYCEFRVLSSCQVTNFTVASTGDRPFSAGILYPRPEGHPEAAAQRLGCWVHDVDF
LTCSWEAGRAAPGDVQYRLYWQDLKTYEEEECPRYAVDDRGTHIRCHFDDVSRLREHVQF
LVKGTSKGARIPCSDLTVELARIERLSLPNITGMCNKSYSVMEWKMSSHFNHRFTYELEI
QKGSDAAYTEKAPDSYFVLPNPGNYAVRLRAHARFRKTWSEWSAVRRFGLGSFQEEKLRT
QTHTEGRTARCGHRDSTASTSQGEGRRDEPASPRLALKAPASRALQGTHICCCRESSPSK
DWAGLQLGPGGQGAEGWRLGCEPVRLAPGAWGWGLGLALGPRYSVLQKLFPPIPHLKDPI
SDTLHSSKLVAWEASRASQEDCQVAEVQVLGEM
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggccttcctgtggctggccttgtgtctcacgcccgcgtgctgtctgctgcacaaggac
gaagatcccgagtcgccaattaagaacctgcgaatgcagccggagacgagaaggttgacc
tgggacctcagcggaaacgtgtctgagattggctgtttcatcaactcgaggttcatcact
aaggccaccgacaagcgttactgcgagttccgcgtactttcctcgtgtcaggtgacgaat
ttcacggtcgcctccaccggagaccggccgttctccgcggggatcctgtaccccaggcca
gagggccaccctgaggcggcggcgcagcgtctgggctgctgggtgcacgacgtggacttc
ctgacgtgcagctgggaggcgggccgcgcggcccccggggacgtccagtatcgcctgtac
tggcaggacctcaagacctacgaggaggaggagtgtccccggtacgcggtggacgatcgg
gggacacacatccggtgtcatttcgacgacgtgtcccggctcagggaacacgtccagttc
ctggtgaagggcaccagcaagggcgcgaggatcccgtgctcggacctcactgtggaacta
gcaagaatcgagagattaagtctgcccaacatcaccggaatgtgtaataaatcctattca
gtcatggagtggaaaatgtcaagccactttaatcacagatttacatacgaacttgaaata
caaaagggctcagatgccgcctacaccgagaaggcgcccgacagctacttcgtgctcccc
aaccccggaaactacgcggtgaggctgagggcgcacgcgcgcttccgcaaaacctggagc
gagtggagcgccgtgcggcgctttggactggggtcctttcaagaagagaagttgaggaca
cagacacacacagagggacggacggccaggtgcggacacagggacagcacggcctctacc
agccaaggagaagggcgtcgggacgaaccagcctcgccccgcctggctctcaaagccccg
gcctccagggctctgcaaggcacacatatctgctgctgcagggaaagctcgccgtctaag
gactgggctgggctgcagctgggccctggggggcagggggcagagggctggaggctgggg
tgtgagcctgtccggctggcacctggggcctggggttgggggctggggctcgcgctgggt
ccaaggtactcggtgctgcagaaactcttccccccgatcccgcacctgaaggaccccatc
agtgacaccctgcacagcagcaagttggtggcctgggaggccagcagagcaagccaggag
gactgccaggtggcagaggtgcaggttctgggagaaatgtga

DBGET integrated database retrieval system