KEGG   Panthera pardus (leopard): 109257654Help
Entry
109257654         CDS       T06062                                 

Gene name
GAMT
Definition
(RefSeq) guanidinoacetate N-methyltransferase
  KO
K00542  guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00260  Glycine, serine and threonine metabolism
ppad00330  Arginine and proline metabolism
ppad01100  Metabolic pathways
Module
ppad_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109257654 (GAMT)
   00330 Arginine and proline metabolism
    109257654 (GAMT)
Enzymes [BR:ppad01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     109257654 (GAMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 109257654
NCBI-ProteinID: XP_019289453
LinkDB All DBs
Position
Unknown
AA seq 465 aa AA seqDB search
MAAALGVPGPLARSRLRKVTGPGALPTAAARICATAAAALPPPLSANGHRAPPRPRRRPA
HARARSRTGPPGAGPGVRPPEVFWEVESPLRRRRPHPAERGSRAEPRACCVLRACAFALR
RSELGTAGRRRGLASLFEFGSEVARGVNSGQRPRPARGHAGWRRPSPRLHLRYFPELVSR
EGMAAAAAAVGETAVTRPVRAPCNPLRAPPTCPGPAPPACGPPRPAPSGLRPPAAPPIFA
PGENCSPAWQMAPAAYDAADMHLQILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGM
AIAASRVQEAPIDEHWIIECNDGVFQRLQDWAQRQPHKVVPLKGLWEEVAPTLPDGHFDG
ILYDTYPLSEETWHTHQFAFIKDHAFRLLKPGGILTYCNLTSWGELMKSKYSDVSTMFQE
TQVPALLEAGFRRENIHTEVMELVPPAECRYYAFPRMITPLVTKH
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgctcggcgtcccgggccccctggctcgctcccgcctccggaaggtcacc
ggccccggcgccctccccacagccgcggcccggatctgcgcaacggcggcggccgcgctg
cctcctcccctcagcgccaacggtcaccgcgcgccaccgcgcccgcgccgccgccctgcg
cacgcccgggcgcgctcccgcacggggcctccgggggcggggccaggggtgcgcccgcct
gaggtgttctgggaagtggagtcccccctgcgccggcgtcgtccccaccccgcggagcgg
ggctcgcgggccgagccgcgtgcgtgctgcgtgctgcgtgcgtgcgcgttcgcgcttagg
cgctccgagctaggcaccgcggggcgcaggcgcggcttggcttccttgtttgagttcggg
tcggaagtggcgcgcggggtcaacagtgggcaaaggccacgcccggcgcggggtcacgcc
gggtggaggcgcccctccccacgcctgcacctccgctacttcccggaactcgtctcccgg
gaggggatggcggctgcagcggcggctgtcggcgagaccgcggtgacgaggcccgtcaga
gctccgtgcaatccgctccgggctccgcccacctgtcccggccccgcccctccggcctgc
gggccgccccgccccgccccctctggcctgcggccncccgccgcgccccccatcttcgcc
cccggcgagaactgcagccccgcgtggcagatggcgcccgcggcctacgacgcggcggac
atgcacctgcagatcctgggcaagccggtgatggagcgctgggagaccccctacatgcac
gcgctggcggccgccgcctcctccaaagggggccgggtcctggaggtaggcttcggcatg
gcgatcgcagcttccagggtgcaagaggcccccatcgacgaacactggatcatcgagtgc
aatgatggcgtcttccagcgcctccaggactgggcccagcggcagccacacaaggtggtt
cccttgaaaggcctgtgggaggaggtggcccctaccctgccagacggccactttgatggt
atcctgtatgacacctaccccctgtccgaggagacctggcatacccaccagttcgccttc
atcaaggaccatgcctttcgcctgctgaagcccgggggcattctcacctactgcaacctc
acgtcgtggggggagctgatgaagtctaagtactcggacgtcagcaccatgttccaggag
acacaggtgccagccctgctggaagcgggcttcaggcgggagaacatccacacggaggtg
atggagctggtcccaccggccgagtgccgctactacgccttccctcgcatgatcacgccc
ctggtcaccaagcactga

DBGET integrated database retrieval system