KEGG   Panthera pardus (leopard): 109258518
Entry
109258518         CDS       T06062                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad01521  EGFR tyrosine kinase inhibitor resistance
ppad04062  Chemokine signaling pathway
ppad04066  HIF-1 signaling pathway
ppad04068  FoxO signaling pathway
ppad04217  Necroptosis
ppad04550  Signaling pathways regulating pluripotency of stem cells
ppad04630  JAK-STAT signaling pathway
ppad04659  Th17 cell differentiation
ppad04917  Prolactin signaling pathway
ppad04920  Adipocytokine signaling pathway
ppad04931  Insulin resistance
ppad04933  AGE-RAGE signaling pathway in diabetic complications
ppad04935  Growth hormone synthesis, secretion and action
ppad05145  Toxoplasmosis
ppad05160  Hepatitis C
ppad05161  Hepatitis B
ppad05162  Measles
ppad05163  Human cytomegalovirus infection
ppad05167  Kaposi sarcoma-associated herpesvirus infection
ppad05169  Epstein-Barr virus infection
ppad05200  Pathways in cancer
ppad05203  Viral carcinogenesis
ppad05205  Proteoglycans in cancer
ppad05206  MicroRNAs in cancer
ppad05212  Pancreatic cancer
ppad05221  Acute myeloid leukemia
ppad05223  Non-small cell lung cancer
ppad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ppad05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109258518 (STAT3)
   04066 HIF-1 signaling pathway
    109258518 (STAT3)
   04068 FoxO signaling pathway
    109258518 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109258518 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109258518 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109258518 (STAT3)
   04062 Chemokine signaling pathway
    109258518 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109258518 (STAT3)
   04917 Prolactin signaling pathway
    109258518 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    109258518 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109258518 (STAT3)
   05206 MicroRNAs in cancer
    109258518 (STAT3)
   05205 Proteoglycans in cancer
    109258518 (STAT3)
   05203 Viral carcinogenesis
    109258518 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109258518 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109258518 (STAT3)
   05221 Acute myeloid leukemia
    109258518 (STAT3)
   05223 Non-small cell lung cancer
    109258518 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109258518 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109258518 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109258518 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    109258518 (STAT3)
   05161 Hepatitis B
    109258518 (STAT3)
   05160 Hepatitis C
    109258518 (STAT3)
   05163 Human cytomegalovirus infection
    109258518 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109258518 (STAT3)
   05169 Epstein-Barr virus infection
    109258518 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109258518 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109258518 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ppad03000]
    109258518 (STAT3)
Transcription factors [BR:ppad03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109258518 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 109258518
NCBI-ProteinID: XP_019290901
Ensembl: ENSPPRG00000011309
LinkDB
Position
Unknown
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctcgacacacggtacctggagcagcttcatcag
ctgtacagtgacagcttcccgatggagctgcggcagtttctggccccttggattgagagt
caagattgggcatatgcggccagcaaagaatcacatgctactttggtgtttcataatctc
ttgggtgagatcgaccagcagtacagccgtttcctacaggaatcgaatgttctctatcag
cacaatctgcgaagaatcaagcagttccttcagagcaggtatctggagaagccaatggag
attgcccgaattgtggcccggtgcctgtgggaagagtcccgcctgctccagactgcggcc
actgcagcccagcaagggggccaggccaaccaccccacggccgccgtggtgacggagaag
cagcagatgctggagcagcacctgcaagatgttcggaagcgagtacaggacctagaacag
aaaatgaaagtcgtagagaatctccaggatgactttgacttcaactataaaaccctcaag
agtcaaggagacatgcaggatctgaatggaaacaaccagtccgtgaccaggcagaagatg
cagcagctggaacagatgctcacggcgctggaccagatgcggcgcagcatcgtgagtgag
ttggcggggctgttgtcagccatggagtatgtgcagaagacgctcacggacgaagagctg
gctgactggaagaggcggcagcagattgcgtgcatcgggggcccgcccaacatctgcctc
gaccgcctagaaaactggataacctcattagcggaatctcaacttcagacccgccaacaa
attaagaaactggaggagttgcagcaaaaagtgtcctacaaaggggatcccattgtacag
caccggccaatgctggaggagaggattgtggagctgtttagaaacttaatgaaaagtgcc
tttgtggttgagcggcagccctgcatgcccatgcatcccgaccggccattggtcatcaag
actggcgtccagttcactaccaaagtcagattgctggtcaaattccctgagttaaattat
cagcttaaaattaaagtgtgcattgacaaagactccggggatgttgcggctctcagagga
tcccggaaatttaacattctgggcacaaacacgaaagtgatgaacatggaagagtccaac
aacggcagcctctctgcagaattcaaacatctgaccctgagagagcaaagatgtggtaac
gggggccgagccaattgtgatgcctccctgattgtcaccgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccagggcctcaagattgaccttgagacccactccttgccg
gttgtggtgatctccaacatctgtcagatgcctaatgcctgggcatctatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaagcccccaattggaacc
tgggatcaagtggctgaggtgctgagctggcagttctcctccaccacaaagcgaggcctg
agcatcgagcagttgacgacgctggcagagaagctcttaggacctggtgtgaactattca
gggtgtcagattacgtgggctaaattttgcaaagaaaacatggccggcaaaggcttctcc
ttctgggtctggctagacaatatcattgatcttgtgaaaaagtacatcctggctctttgg
aatgaagggtacataatgggttttatcagtaaggagcgggagcgggccatcttgagcacc
aagcccccaggcaccttcctgctaagattcagtgaaagcagcaaagaaggaggtgtcacc
ttcacttgggtggagaaggacatcagcggcaagacccagatccagtccgtggaaccatat
accaagcagcagctgaacaacatgtcgtttgctgaaatcatcatgggctataagatcatg
gatgctaccaacatcctcgtgtctccgctggtttatctctacccggacattcctaaggag
gaggcgtttggaaagtattgtcgaccagaaagccaggagcatcctgaagctgacccaggt
agtgctgccccatacctgaagaccaagtttatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgaaccctcagcaggagggcagtttgaatccctcacgttcgacatggag
ttgacctcggagtgcgccacctccccaatgtga

DBGET integrated database retrieval system