KEGG   Panthera pardus (leopard): 109260558
Entry
109260558         CDS       T06062                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04022  cGMP-PKG signaling pathway
ppad04141  Protein processing in endoplasmic reticulum
ppad04151  PI3K-Akt signaling pathway
ppad04211  Longevity regulating pathway
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04668  TNF signaling pathway
ppad04728  Dopaminergic synapse
ppad04911  Insulin secretion
ppad04915  Estrogen signaling pathway
ppad04918  Thyroid hormone synthesis
ppad04925  Aldosterone synthesis and secretion
ppad04926  Relaxin signaling pathway
ppad04927  Cortisol synthesis and secretion
ppad04928  Parathyroid hormone synthesis, secretion and action
ppad04934  Cushing syndrome
ppad04935  Growth hormone synthesis, secretion and action
ppad05020  Prion disease
ppad05030  Cocaine addiction
ppad05031  Amphetamine addiction
ppad05034  Alcoholism
ppad05161  Hepatitis B
ppad05163  Human cytomegalovirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109260558 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109260558 (ATF6B)
   04022 cGMP-PKG signaling pathway
    109260558 (ATF6B)
   04151 PI3K-Akt signaling pathway
    109260558 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109260558 (ATF6B)
   04915 Estrogen signaling pathway
    109260558 (ATF6B)
   04926 Relaxin signaling pathway
    109260558 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    109260558 (ATF6B)
   04918 Thyroid hormone synthesis
    109260558 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    109260558 (ATF6B)
   04925 Aldosterone synthesis and secretion
    109260558 (ATF6B)
   04927 Cortisol synthesis and secretion
    109260558 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109260558 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    109260558 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    109260558 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109260558 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    109260558 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    109260558 (ATF6B)
   05031 Amphetamine addiction
    109260558 (ATF6B)
   05034 Alcoholism
    109260558 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109260558 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109260558 (ATF6B)
   05161 Hepatitis B
    109260558 (ATF6B)
   05163 Human cytomegalovirus infection
    109260558 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ppad03000]
    109260558 (ATF6B)
Transcription factors [BR:ppad03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109260558 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 109260558
NCBI-ProteinID: XP_019294413
Ensembl: ENSPPRG00000010646
LinkDB
Position
Unknown
AA seq 743 aa
MAGGREGKMAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYTGLDDVAEEQTQLFRCP
EQDVPFGSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPS
SQVPAVGEVLVVKTESLAPPLCLLGDDPTSPFETVQINVGPTSDDPSVIISEEGSRWLVD
KKGKEIHFTELPFGPLEFYVQTKLEPVSPSSSINSEASLLSAESPNQGFIGEEVLEVKTE
SPSPQGCLLRDVLGPPLGGVQISMGPSSDGSLGKALPTRKPPLQPKPVVITTVPMPPRAV
PPSTTILLQPLVQPPPVSPVVLIQGAIRVQPEGPAPPAPRPERKSIVPAPMPGNSCPPEV
DAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLADNQQLRRENAALRRRLEAL
LAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISDPPPAPISPRMSREEPRPRRHLLE
FSAQEPVHGVEPLQGSSLGPEEPQPSPPGRPSFRNLTAFPGGSAKELLLRDLDQLFLSSD
CRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQLWKKSPPVKAVPTQPPGPP
ERDSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLV
MPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTSTVPPSLRKQPSSTPGNATGG
PLPASAAGQARQASHQPLYLNHP
NT seq 2232 nt   +upstreamnt  +downstreamnt
atggctggggggcgggagggaaagatggcggaactgatgctgctcagcgagattgcggac
ccaacacgttttttcaccgataacttgctgagcccggaggactggggtctgcggaacagc
accttgtatactggcttagatgatgtcgcggaggagcagacgcagctcttccgttgccca
gagcaggatgtcccgtttggcagcagttccctggatgtggggatggatgtcagccctcct
gagccaccctgggaccccctgcctatctttccagaccttcaggtgaagtctgagccatcc
tccccctgctcctcttcctccctcagctctgaatcatcgcgtctttccacagagccctct
agccaggtccctgctgtaggggaggtgctggttgtgaagacagagtccttggcaccccca
ctctgcctcctaggagatgatccaacatccccatttgaaacggtccagatcaatgtgggt
cccacctctgatgacccctcagtgatcatctctgaggagggatccaggtggctggtagac
aagaaagggaaggagatccacttcactgaattaccttttggtcctttggagttttatgtc
cagaccaagctagagcctgtctctccatcttcctccatcaactctgaggcttccctgctc
tcagcagagtcccccaaccagggttttataggagaggaggtactggaagtgaagacagag
tcaccatcccctcaagggtgtctcctgcgggatgtcctaggccccccacttggaggtgtc
cagatcagcatgggcccatcctccgatggctccttaggcaaagccctgcccacccgaaag
ccaccgctgcagcccaaacctgtggtgataaccactgtcccaatgccacccagagctgtg
cctcccagcaccaccatccttttgcagcctcttgtccaaccacccccagtgtcaccagtt
gtcctcatccaaggtgctattcgggtccagcctgaggggccggccccccctgctccaagg
cctgaaaggaagagcattgttccagctcctatgcctgggaactcctgcccacctgaagtg
gatgcaaagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcagcctgccag
tccaggaggaagaagaaggagtatctgcaggggctggaggctcggctgcaggctgtgctg
gccgacaaccagcagctccgcagggagaatgctgccctccggcggcggctggaggccctg
ctggccgaaaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatcatg
gtgttccttcttttcattgccttcaactttggacctgtcagcatcagtgaccctcctcca
gctcccatctctcctcggatgagcagagaggagcctcgaccccggagacacttgctggag
ttctcagcgcaagagccggttcatggagttgaacccctccagggttcctccctgggccct
gaggagccccagcccagccccccaggccggccaagtttcaggaacctgacagccttcccg
gggggcagtgccaaggagctgctgctgagagacctggaccagctcttcctctcctctgat
tgccggcacttcaaccgaaccgagtccctgaggcttgcggacgagctgagcggctgggtc
cagcgtcaccagagaggccggcggaagatcccccagagggcccaggagagacagaagtct
cagctctggaagaagtcgcctccagttaaggcagttcccacccaaccccctgggccccca
gaaagggattctgtgggccaactgcagctatatcgccacccagaccgttcgcagccagag
ttcctggatgcaattgaccgacgagaagacacattttatgttgtgtccttccgaagggac
cacttgctgctccctgccatcagccacaacaagacctctcggcccaagatgtccctggtg
atgcctgccatggcccccaatgagaccctgtcaggccggggggctccaggagactatgag
gagatgatgcagatcgagtgtgaggtcatggacacccgggtgattcacatcaagacctcc
acggtgcctccctcgctccgaaaacagccatcctcgaccccaggcaatgccacaggtggc
cccttgccagcttctgcagccggccaggcacgccaggcctcccaccagcccctctacctc
aatcacccctga

DBGET integrated database retrieval system