KEGG   Panthera pardus (leopard): 109260733
Entry
109260733         CDS       T06062                                 

Gene name
NLRP4
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppad04131]
    109260733 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ppad04054]
    109260733 (NLRP4)
Membrane trafficking [BR:ppad04131]
 Autophagy
  Other autophagy associated proteins
   Others
    109260733 (NLRP4)
Pattern recognition receptors [BR:ppad04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   109260733 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 PIN_12 AAA_16 AAA_25
Other DBs
NCBI-GeneID: 109260733
NCBI-ProteinID: XP_019294705
Ensembl: ENSPPRG00000009587
LinkDB
Position
Unknown
AA seq 985 aa
MASSFFSDFGLMWYLKELKKDEFRKFKELLKQEPLKLGLKIIPWTEVKKATREDLANLLM
RHYKEQQAWNVTFSVFNKINRKDLCEKAKKEITGHTKLYQMHVKEKFNNMWLRESIPRIQ
DHLHPELTQRERECLELFFAPKETGKQTRTVLLKGVQGIGKTTFLIRLMLAWVEGNLYQE
RFSYVFYLCCREMKQLTETSLAALLSRGWSDSSTPFVEILSQPERLLFLIDSFEELKCSL
SEPESDLCSDCMERVPVQVLLSSLLRKKLLPESSLLITAAPVYPQEVEDRLERPEIRTLL
GFSDSDKKIYFCSMFQDRNRAMEAFSFMRENGHLFIMCQIPILCWIVSTCLKQEMEKGKD
LALTCRRTTSLYSSFIFNLFTPKGASCPDEQSQGQLKGLCSLAAEGMWTNMFLFSEGDLR
RNGLVDSDISTLLDIKALQKCKEEENSYMFLHVSVQEFCAAMFYFLKSHMDHPNPAIGCR
KAVLFTYLKKEKVHWISLGCFIFGLLNEKEQEKLDTVFGFHLSQEIQQECHQCLQRIGEN
KHLRKQIDFLALCYCLFEMQNEVFVQWAMDFFQDVHFTITDHMDLRVSAYCLKYCSNLQK
LCFSIQNVFQVGNADSSVSSYNILCWHDICSVLTTNEHLRELQMSHSILSESTYATLCHQ
LRHPSCHLQKLQMNNVTFAGDRWLFFEVLTHSPDLKYLNLSGTTLSRNDVKLLCNALNNP
MCNVEELLLANCHLSADDCEAFTCVLNSSKKLKLLNVSYNYLDQGVPLLCEALQRPDCGL
EGLILGYCYLTEHSWKYLYNVLLYNKSLTHLDLSANVLKYENLKLLCEALKQPGCHLWSL
CLVKCSITADGCRDLASVLTGNQNLRSLQISYNDIEDAGVKLLCQGLAHPSCHLEILGLA
TCKLTSACCEDLSSALTSSKTLQSLNLQGNALDHTGVAVLCEALRHPACTLQILGLQKTE
FDEETQRLLTVAEEENPSLTVIGDW
NT seq 2958 nt   +upstreamnt  +downstreamnt
atggcgtcatctttcttttctgattttggcctgatgtggtacctgaaggagctcaaaaag
gatgagttcagaaaatttaaggagctcctaaaacaggagcctctgaagcttggactcaag
ataattccctggactgaagtaaagaaggcaacacgggaagatcttgcaaacctgctgatg
aggcattacaaggaacagcaagcatggaacgtgactttcagtgtctttaacaagatcaat
agaaaagatctctgtgagaaggcaaagaaagagatcacaggacacacaaagttgtaccaa
atgcacgtgaaggagaaattcaacaacatgtggctcagagaatctatccccaggattcaa
gatcacttacatcctgaactcacccagagagaacgtgaatgcttggaactgttttttgct
cctaaggaaactgggaaacagacacggacggtgctcctcaaaggagtacaagggattggg
aagacaacattcctgatcaggctgatgttggcctgggtggagggcaacctctaccaggag
agattctcctatgttttctacctctgctgccgggaaatgaagcagttgacagagaccagt
ttggctgcactcctctctagaggctggtctgactcctccactccttttgtggagatcctg
tcccaaccagagagactcttgtttctcatagacagcttcgaagaactgaaatgtagcctg
agtgaacctgagtcggatctgtgcagcgactgtatggagcgggtgccagtacaggtgctc
ctgagcagcttgctgaggaagaaattgctccccgagtcctcgctgctcatcactgctgca
cctgtgtacccccaggaagttgaggataggttggagcgcccagaaattagaacactcctg
ggattcagtgacagtgataagaagatctatttctgctctatgtttcaagaccggaataga
gccatggaagccttcagtttcatgagagaaaatgggcatttgtttatcatgtgccaaatc
cccatcctttgctggattgtgagcacttgtctgaagcaggaaatggaaaaggggaaagac
ctggcactgacctgccgacgtaccacctctctttatagctctttcatctttaacttgttc
acgcccaagggggctagctgtccagatgagcaaagccaaggccagttgaagggcttgtgt
tccctggctgcagagggtatgtggaccaacatgtttttgttcagtgaaggggacctcagg
agaaatgggttagttgattctgacatctctacgttgctggacataaaggctcttcagaag
tgcaaggaggaggagaactcctacatgtttctccatgtgagcgtccaggagttctgtgcc
gccatgttctattttctaaagagccacatggaccatcctaacccagctattggatgtaga
aaagctgtgctatttacctatttgaagaaagaaaaggtacattggatttctttggggtgt
ttcatatttggccttttaaatgaaaaggaacaagaaaagctggatacagtttttggcttt
cacctgtcccaggagatacagcaggaatgtcaccagtgcttgcagcgcataggtgagaac
aagcatcttcggaaacagatagatttcttggcattgtgttactgtctgtttgagatgcag
aatgaagtttttgtgcagtgggcaatggacttcttccaagatgttcactttaccatcacg
gaccacatggacttgcgggtttctgcctactgcttaaaatactgttccaatttgcagaag
ctttgcttctccatccagaatgtctttcaagtgggaaatgcagacagctctgtgtcaagt
tacaatatcctctgttggcatgatatctgctctgtgctcactacaaatgagcacctcaga
gaactccaaatgagtcacagtatcctcagtgagtcaacctatgcaactttgtgtcatcag
ctgaggcatcccagctgtcaccttcaaaagcttcagatgaataatgttaccttcgctggt
gacaggtggcttttctttgaggtgctcactcatagtccagatttgaaatacctgaacctc
agtggtacaacactctcgcgcaatgatgtgaagttgctctgtaatgccctcaacaatcca
atgtgcaatgtagaagaactactgctggcaaattgtcacctttcagcagatgattgtgaa
gcctttacctgcgtcctaaacagcagcaagaagctgaagcttcttaatgtatcctacaac
tacctggaccaaggggtacccttgctgtgtgaggccttgcagcgccctgactgtggtcta
gagggcttgatattaggttactgttacctcactgaacactcctggaaatacctctacaac
gttcttctgtataacaaaagcttgacccatctagacctcagcgccaacgtcctgaaatat
gaaaacttgaaacttctctgtgaggccttgaagcagccaggctgccacctgtggtcactg
tgtttggtgaaatgttccatcaccgctgatggctgtcgagacctcgcctcagtcctcact
ggcaatcagaacttgagaagtctacaaatcagctacaatgacatagaagatgctggtgtg
aagctgctgtgtcaaggtctagcacatcccagctgtcacttagagattcttgggctggct
acatgcaagttaacaagtgcctgctgtgaggacctctctagtgccctcaccagcagtaaa
accctgcagagtctgaacctgcaaggaaacgccctggaccacactggagtggcggtgcta
tgtgaagccctgagacacccagcctgcaccctgcagattctagggctccaaaaaactgaa
tttgatgaggaaacccagagacttctgacagttgcagaagaagaaaatccctccttgaca
gttataggtgactggtga

DBGET integrated database retrieval system