KEGG   Panthera pardus (leopard): 109265299
Entry
109265299         CDS       T06062                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04010  MAPK signaling pathway
ppad04014  Ras signaling pathway
ppad04015  Rap1 signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04151  PI3K-Akt signaling pathway
ppad04640  Hematopoietic cell lineage
ppad04916  Melanogenesis
ppad05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109265299 (KITLG)
   04014 Ras signaling pathway
    109265299 (KITLG)
   04015 Rap1 signaling pathway
    109265299 (KITLG)
   04072 Phospholipase D signaling pathway
    109265299 (KITLG)
   04151 PI3K-Akt signaling pathway
    109265299 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109265299 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    109265299 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109265299 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ppad04052]
    109265299 (KITLG)
Cytokines and growth factors [BR:ppad04052]
 Growth factors
  Growth factors (RTK binding)
   109265299 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 109265299
NCBI-ProteinID: XP_019301935
Ensembl: ENSPPRG00000007405
LinkDB
Position
Unknown
AA seq 277 aa
MDLYTIHSTWIVTCIYLQLLLFNPLVKTKGLCRNRVTDDVKDVTKLVANLPKDYKIALKY
VPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEG
HSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSR
VSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFY
WKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 834 nt   +upstreamnt  +downstreamnt
atggacctatacaccatccacagcacttggattgtcacttgcatttatcttcagctgctc
ctatttaaccctctggtcaaaactaaagggctctgcaggaaccgtgtgactgatgatgtg
aaagacgttacaaaattggtggcaaatcttccaaaagactataagatagccctcaaatat
gtccccgggatggatgttttgcctagtcattgttggataagcgtgatggtggaacagttg
tcagtcagcttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaat
tattctatcatagacaaacttgtgaaaatagtggatgaccttgtggagtgcgtggaagga
cactcatctgagaatgtaaaaaaatcatctaagagcccagaacccaggctttttactcct
gaagaattctttagaatttttaatagatccattgatgccttcaaggacttggagatggtg
gcatctaaaactagtgaatgtgtggtttcttcaacattaagtcccgaaaaagattccagg
gtcagtgtcacaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgac
agcagtagcagtaataggaaggccacaaatcccatagaagactccagcatacaatgggca
gtcatggcattaccagcgtgcttttctcttgtaatcggatttgcttttggagccttctac
tggaagaagaaacaaccgaatctcacaaggacagttgaaaatatacagattaacgaagag
gataatgagataagtatgctgcaagaaaaagagagagagtttcaagaggtgtaa

DBGET integrated database retrieval system