KEGG   Panthera pardus (leopard): 109268629
Entry
109268629         CDS       T06062                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad01522  Endocrine resistance
ppad04012  ErbB signaling pathway
ppad04066  HIF-1 signaling pathway
ppad04068  FoxO signaling pathway
ppad04110  Cell cycle
ppad04151  PI3K-Akt signaling pathway
ppad04933  AGE-RAGE signaling pathway in diabetic complications
ppad04934  Cushing syndrome
ppad05162  Measles
ppad05165  Human papillomavirus infection
ppad05169  Epstein-Barr virus infection
ppad05200  Pathways in cancer
ppad05202  Transcriptional misregulation in cancer
ppad05203  Viral carcinogenesis
ppad05206  MicroRNAs in cancer
ppad05215  Prostate cancer
ppad05220  Chronic myeloid leukemia
ppad05222  Small cell lung cancer
ppad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109268629 (CDKN1B)
   04066 HIF-1 signaling pathway
    109268629 (CDKN1B)
   04068 FoxO signaling pathway
    109268629 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    109268629 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109268629 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109268629 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    109268629 (CDKN1B)
   05206 MicroRNAs in cancer
    109268629 (CDKN1B)
   05203 Viral carcinogenesis
    109268629 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    109268629 (CDKN1B)
   05220 Chronic myeloid leukemia
    109268629 (CDKN1B)
   05215 Prostate cancer
    109268629 (CDKN1B)
   05222 Small cell lung cancer
    109268629 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109268629 (CDKN1B)
   04934 Cushing syndrome
    109268629 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    109268629 (CDKN1B)
   05169 Epstein-Barr virus infection
    109268629 (CDKN1B)
   05165 Human papillomavirus infection
    109268629 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109268629 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109268629
NCBI-ProteinID: XP_019307562
Ensembl: ENSPPRG00000021769
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGNRQAVPLIG
SQANTEDTHLVDQKTDTSDNQTGLAEQCPGIRKRPATDDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccctccgcctgcaggaacctcttcggcccggtcaaccacgaagag
ttgacccgggacttggagaagcactgcagagacatggaagaggcaagccagcgcaagtgg
aattttgatttccagaatcacaagcccctggagggcaaatacgagtggcaagaggtggaa
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggaaccgccaggcggtgcctttaattggg
tctcaggcaaacacagaggacacacatttggtagaccaaaagactgatacatcggacaac
cagacggggttagcggagcagtgccctgggataaggaagcgacctgctacagatgattcc
tctcctcagaacaaaagagccaacagaacagaagaaaatgtctcagacggttccccgaac
gcgggttcagtggagcagacgcccaagaagcctggcctgagaagacgtcaaacgtaa

DBGET integrated database retrieval system