Panthera pardus (leopard): 109270472 Help Entry 109270472         CDS       T06062                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism ppad  Panthera pardus (leopard) Pathway ppad03050   Proteasome ppad04060   Cytokine-cytokine receptor interaction ppad04066   HIF-1 signaling pathway ppad04217   Necroptosis ppad04350   TGF-beta signaling pathway ppad04380   Osteoclast differentiation ppad04612   Antigen processing and presentation ppad04630   JAK-STAT signaling pathway ppad04650   Natural killer cell mediated cytotoxicity ppad04657   IL-17 signaling pathway ppad04658   Th1 and Th2 cell differentiation ppad04659   Th17 cell differentiation ppad04660   T cell receptor signaling pathway ppad04940   Type I diabetes mellitus ppad05140   Leishmaniasis ppad05142   Chagas disease ppad05143   African trypanosomiasis ppad05144   Malaria ppad05145   Toxoplasmosis ppad05146   Amoebiasis ppad05152   Tuberculosis ppad05160   Hepatitis C ppad05164   Influenza A ppad05168   Herpes simplex virus 1 infection ppad05200   Pathways in cancer ppad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ppad05321   Inflammatory bowel disease ppad05322   Systemic lupus erythematosus ppad05323   Rheumatoid arthritis ppad05330   Allograft rejection ppad05332   Graft-versus-host disease ppad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     109270472 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     109270472 (IFNG)    04630 JAK-STAT signaling pathway     109270472 (IFNG)    04066 HIF-1 signaling pathway     109270472 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109270472 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109270472 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     109270472 (IFNG)    04612 Antigen processing and presentation     109270472 (IFNG)    04660 T cell receptor signaling pathway     109270472 (IFNG)    04658 Th1 and Th2 cell differentiation     109270472 (IFNG)    04659 Th17 cell differentiation     109270472 (IFNG)    04657 IL-17 signaling pathway     109270472 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     109270472 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109270472 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109270472 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     109270472 (IFNG)    05164 Influenza A     109270472 (IFNG)    05168 Herpes simplex virus 1 infection     109270472 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     109270472 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     109270472 (IFNG)    05144 Malaria     109270472 (IFNG)    05145 Toxoplasmosis     109270472 (IFNG)    05140 Leishmaniasis     109270472 (IFNG)    05142 Chagas disease     109270472 (IFNG)    05143 African trypanosomiasis     109270472 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     109270472 (IFNG)    05323 Rheumatoid arthritis     109270472 (IFNG)    05321 Inflammatory bowel disease     109270472 (IFNG)    05330 Allograft rejection     109270472 (IFNG)    05332 Graft-versus-host disease     109270472 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109270472 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109270472 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:ppad03051]     109270472 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppad04052]     109270472 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:ppad00536]     109270472 (IFNG) Proteasome [BR:ppad03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     109270472 (IFNG) Cytokines and neuropeptides [BR:ppad04052]  Cytokines   Interferons    109270472 (IFNG) Glycosaminoglycan binding proteins [BR:ppad00536]  Heparan sulfate / Heparin   Cytokines    109270472 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma COG6_C MSP1_C Motif Other DBs NCBI-GeneID:  109270472 NCBI-ProteinID:  XP_019310583 Ensembl:  ENSPPRG00000009194 UniProt:  A0A9V1FWJ6 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search MNYTSFIFAFQLCIILCSSGCYCQAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWK EESDKTIIQSQIVSFYLKMFENLKDDDQRIQRNMDTIKEDMLDKLLNTSSSKRDDFLKLI QIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atgaattacacaagttttattttcgcttttcagctttgcataattttgtgttcttctggt tgttactgtcaggccatgttttttaaagaaatagaagagctaaagggatattttaatgca agtaatccagatgtagcagatggtgggtcgcttttcgtagacattttgaagaactggaaa gaggagagtgataaaacaataattcaaagccaaattgtctccttctacttgaaaatgttt gaaaacctgaaagatgatgaccagcgcattcaaaggaacatggacaccatcaaggaagac atgcttgataagttgttaaataccagctccagtaaacgggatgacttcctcaagctgatt caaatccctgtgaatgatctgcaggtccagcgcaaagcaataaatgaactcttcaaagtg atgaacgatctctcaccaagatctaacctgaggaagcggaaaaggagtcagaatctgttt cgaggccgtagagcatcgaaataa

DBGET integrated database retrieval system