KEGG   Panthera pardus (leopard): 109271531
Entry
109271531         CDS       T06062                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad01522  Endocrine resistance
ppad01524  Platinum drug resistance
ppad04012  ErbB signaling pathway
ppad04066  HIF-1 signaling pathway
ppad04068  FoxO signaling pathway
ppad04110  Cell cycle
ppad04115  p53 signaling pathway
ppad04151  PI3K-Akt signaling pathway
ppad04218  Cellular senescence
ppad04630  JAK-STAT signaling pathway
ppad04921  Oxytocin signaling pathway
ppad04928  Parathyroid hormone synthesis, secretion and action
ppad04934  Cushing syndrome
ppad05160  Hepatitis C
ppad05161  Hepatitis B
ppad05163  Human cytomegalovirus infection
ppad05165  Human papillomavirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05167  Kaposi sarcoma-associated herpesvirus infection
ppad05169  Epstein-Barr virus infection
ppad05200  Pathways in cancer
ppad05202  Transcriptional misregulation in cancer
ppad05203  Viral carcinogenesis
ppad05205  Proteoglycans in cancer
ppad05206  MicroRNAs in cancer
ppad05210  Colorectal cancer
ppad05211  Renal cell carcinoma
ppad05212  Pancreatic cancer
ppad05213  Endometrial cancer
ppad05214  Glioma
ppad05215  Prostate cancer
ppad05216  Thyroid cancer
ppad05217  Basal cell carcinoma
ppad05218  Melanoma
ppad05219  Bladder cancer
ppad05220  Chronic myeloid leukemia
ppad05222  Small cell lung cancer
ppad05223  Non-small cell lung cancer
ppad05224  Breast cancer
ppad05225  Hepatocellular carcinoma
ppad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109271531 (CDKN1A)
   04630 JAK-STAT signaling pathway
    109271531 (CDKN1A)
   04066 HIF-1 signaling pathway
    109271531 (CDKN1A)
   04068 FoxO signaling pathway
    109271531 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    109271531 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109271531 (CDKN1A)
   04115 p53 signaling pathway
    109271531 (CDKN1A)
   04218 Cellular senescence
    109271531 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109271531 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    109271531 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109271531 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    109271531 (CDKN1A)
   05206 MicroRNAs in cancer
    109271531 (CDKN1A)
   05205 Proteoglycans in cancer
    109271531 (CDKN1A)
   05203 Viral carcinogenesis
    109271531 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109271531 (CDKN1A)
   05212 Pancreatic cancer
    109271531 (CDKN1A)
   05225 Hepatocellular carcinoma
    109271531 (CDKN1A)
   05226 Gastric cancer
    109271531 (CDKN1A)
   05214 Glioma
    109271531 (CDKN1A)
   05216 Thyroid cancer
    109271531 (CDKN1A)
   05220 Chronic myeloid leukemia
    109271531 (CDKN1A)
   05217 Basal cell carcinoma
    109271531 (CDKN1A)
   05218 Melanoma
    109271531 (CDKN1A)
   05211 Renal cell carcinoma
    109271531 (CDKN1A)
   05219 Bladder cancer
    109271531 (CDKN1A)
   05215 Prostate cancer
    109271531 (CDKN1A)
   05213 Endometrial cancer
    109271531 (CDKN1A)
   05224 Breast cancer
    109271531 (CDKN1A)
   05222 Small cell lung cancer
    109271531 (CDKN1A)
   05223 Non-small cell lung cancer
    109271531 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109271531 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109271531 (CDKN1A)
   05161 Hepatitis B
    109271531 (CDKN1A)
   05160 Hepatitis C
    109271531 (CDKN1A)
   05163 Human cytomegalovirus infection
    109271531 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109271531 (CDKN1A)
   05169 Epstein-Barr virus infection
    109271531 (CDKN1A)
   05165 Human papillomavirus infection
    109271531 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109271531 (CDKN1A)
   01522 Endocrine resistance
    109271531 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109271531
NCBI-ProteinID: XP_019312489
Ensembl: ENSPPRG00000011957
LinkDB
Position
Unknown
AA seq 164 aa
MSEPSRDAHQIPHGSKACRRLFGPVDSEQLRRDCDALMAGCVQEARERWNFDFVTETPLE
GDFAWERVWGLGLPKLYLPAGPRGGRDDLGGGKRPSTSSTLLPGTAREDHLDLSLSCTLM
PHSPERPEASPGAPGTSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccatccagggatgcccaccagatcccacatggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgcgccgagactgtgacgcgttaatggcaggc
tgcgtgcaggaggcccgggagcgatggaacttcgactttgtcaccgagacaccgctggag
ggcgactttgcctgggagcgtgtgtggggcctgggcctgcccaagctctacctgcctgca
gggccccgggggggccgggatgacctgggagggggcaagcggcccagcacctcgtctacc
ctgctgccggggacagctcgggaggaccacctggacctgtccctgtcctgcactctcatg
cctcactcccctgagcggcccgaggcgtctccgggtgcacctggcacctctcagggccga
aaacggcggcagaccagcatgacagatttctatcactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system