Panthera pardus (leopard): 109272105 Help Entry 109272105         CDS       T06062                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ppad  Panthera pardus (leopard) Pathway ppad01521   EGFR tyrosine kinase inhibitor resistance ppad01522   Endocrine resistance ppad04010   MAPK signaling pathway ppad04012   ErbB signaling pathway ppad04014   Ras signaling pathway ppad04015   Rap1 signaling pathway ppad04062   Chemokine signaling pathway ppad04068   FoxO signaling pathway ppad04071   Sphingolipid signaling pathway ppad04072   Phospholipase D signaling pathway ppad04137   Mitophagy - animal ppad04140   Autophagy - animal ppad04150   mTOR signaling pathway ppad04151   PI3K-Akt signaling pathway ppad04210   Apoptosis ppad04211   Longevity regulating pathway ppad04213   Longevity regulating pathway - multiple species ppad04218   Cellular senescence ppad04360   Axon guidance ppad04370   VEGF signaling pathway ppad04371   Apelin signaling pathway ppad04540   Gap junction ppad04550   Signaling pathways regulating pluripotency of stem cells ppad04625   C-type lectin receptor signaling pathway ppad04650   Natural killer cell mediated cytotoxicity ppad04660   T cell receptor signaling pathway ppad04662   B cell receptor signaling pathway ppad04664   Fc epsilon RI signaling pathway ppad04714   Thermogenesis ppad04720   Long-term potentiation ppad04722   Neurotrophin signaling pathway ppad04725   Cholinergic synapse ppad04726   Serotonergic synapse ppad04730   Long-term depression ppad04810   Regulation of actin cytoskeleton ppad04910   Insulin signaling pathway ppad04912   GnRH signaling pathway ppad04915   Estrogen signaling pathway ppad04916   Melanogenesis ppad04917   Prolactin signaling pathway ppad04919   Thyroid hormone signaling pathway ppad04921   Oxytocin signaling pathway ppad04926   Relaxin signaling pathway ppad04929   GnRH secretion ppad04933   AGE-RAGE signaling pathway in diabetic complications ppad04935   Growth hormone synthesis, secretion and action ppad05010   Alzheimer disease ppad05022   Pathways of neurodegeneration - multiple diseases ppad05034   Alcoholism ppad05160   Hepatitis C ppad05161   Hepatitis B ppad05163   Human cytomegalovirus infection ppad05165   Human papillomavirus infection ppad05166   Human T-cell leukemia virus 1 infection ppad05167   Kaposi sarcoma-associated herpesvirus infection ppad05170   Human immunodeficiency virus 1 infection ppad05200   Pathways in cancer ppad05203   Viral carcinogenesis ppad05205   Proteoglycans in cancer ppad05206   MicroRNAs in cancer ppad05207   Chemical carcinogenesis - receptor activation ppad05208   Chemical carcinogenesis - reactive oxygen species ppad05210   Colorectal cancer ppad05211   Renal cell carcinoma ppad05213   Endometrial cancer ppad05214   Glioma ppad05215   Prostate cancer ppad05216   Thyroid cancer ppad05218   Melanoma ppad05219   Bladder cancer ppad05220   Chronic myeloid leukemia ppad05221   Acute myeloid leukemia ppad05223   Non-small cell lung cancer ppad05224   Breast cancer ppad05225   Hepatocellular carcinoma ppad05226   Gastric cancer ppad05230   Central carbon metabolism in cancer ppad05231   Choline metabolism in cancer ppad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ppad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109272105 (NRAS)    04012 ErbB signaling pathway     109272105 (NRAS)    04014 Ras signaling pathway     109272105 (NRAS)    04015 Rap1 signaling pathway     109272105 (NRAS)    04370 VEGF signaling pathway     109272105 (NRAS)    04371 Apelin signaling pathway     109272105 (NRAS)    04068 FoxO signaling pathway     109272105 (NRAS)    04072 Phospholipase D signaling pathway     109272105 (NRAS)    04071 Sphingolipid signaling pathway     109272105 (NRAS)    04151 PI3K-Akt signaling pathway     109272105 (NRAS)    04150 mTOR signaling pathway     109272105 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109272105 (NRAS)    04137 Mitophagy - animal     109272105 (NRAS)   09143 Cell growth and death    04210 Apoptosis     109272105 (NRAS)    04218 Cellular senescence     109272105 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     109272105 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     109272105 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109272105 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109272105 (NRAS)    04650 Natural killer cell mediated cytotoxicity     109272105 (NRAS)    04660 T cell receptor signaling pathway     109272105 (NRAS)    04662 B cell receptor signaling pathway     109272105 (NRAS)    04664 Fc epsilon RI signaling pathway     109272105 (NRAS)    04062 Chemokine signaling pathway     109272105 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     109272105 (NRAS)    04929 GnRH secretion     109272105 (NRAS)    04912 GnRH signaling pathway     109272105 (NRAS)    04915 Estrogen signaling pathway     109272105 (NRAS)    04917 Prolactin signaling pathway     109272105 (NRAS)    04921 Oxytocin signaling pathway     109272105 (NRAS)    04926 Relaxin signaling pathway     109272105 (NRAS)    04935 Growth hormone synthesis, secretion and action     109272105 (NRAS)    04919 Thyroid hormone signaling pathway     109272105 (NRAS)    04916 Melanogenesis     109272105 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     109272105 (NRAS)    04726 Serotonergic synapse     109272105 (NRAS)    04720 Long-term potentiation     109272105 (NRAS)    04730 Long-term depression     109272105 (NRAS)    04722 Neurotrophin signaling pathway     109272105 (NRAS)   09158 Development and regeneration    04360 Axon guidance     109272105 (NRAS)   09149 Aging    04211 Longevity regulating pathway     109272105 (NRAS)    04213 Longevity regulating pathway - multiple species     109272105 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     109272105 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109272105 (NRAS)    05206 MicroRNAs in cancer     109272105 (NRAS)    05205 Proteoglycans in cancer     109272105 (NRAS)    05207 Chemical carcinogenesis - receptor activation     109272105 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     109272105 (NRAS)    05203 Viral carcinogenesis     109272105 (NRAS)    05230 Central carbon metabolism in cancer     109272105 (NRAS)    05231 Choline metabolism in cancer     109272105 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109272105 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     109272105 (NRAS)    05225 Hepatocellular carcinoma     109272105 (NRAS)    05226 Gastric cancer     109272105 (NRAS)    05214 Glioma     109272105 (NRAS)    05216 Thyroid cancer     109272105 (NRAS)    05221 Acute myeloid leukemia     109272105 (NRAS)    05220 Chronic myeloid leukemia     109272105 (NRAS)    05218 Melanoma     109272105 (NRAS)    05211 Renal cell carcinoma     109272105 (NRAS)    05219 Bladder cancer     109272105 (NRAS)    05215 Prostate cancer     109272105 (NRAS)    05213 Endometrial cancer     109272105 (NRAS)    05224 Breast cancer     109272105 (NRAS)    05223 Non-small cell lung cancer     109272105 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109272105 (NRAS)    05170 Human immunodeficiency virus 1 infection     109272105 (NRAS)    05161 Hepatitis B     109272105 (NRAS)    05160 Hepatitis C     109272105 (NRAS)    05163 Human cytomegalovirus infection     109272105 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     109272105 (NRAS)    05165 Human papillomavirus infection     109272105 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     109272105 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     109272105 (NRAS)   09165 Substance dependence    05034 Alcoholism     109272105 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109272105 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     109272105 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109272105 (NRAS)    01522 Endocrine resistance     109272105 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppad04131]     109272105 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppad04147]     109272105 (NRAS)    04031 GTP-binding proteins [BR:ppad04031]     109272105 (NRAS) Membrane trafficking [BR:ppad04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     109272105 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     109272105 (NRAS) Exosome [BR:ppad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109272105 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    109272105 (NRAS)   Exosomal proteins of breast cancer cells    109272105 (NRAS)   Exosomal proteins of colorectal cancer cells    109272105 (NRAS) GTP-binding proteins [BR:ppad04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109272105 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  109272105 NCBI-ProteinID:  XP_019313476 Ensembl:  ENSPPRG00000007102 UniProt:  A0A9V1G1Z8 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaacaatagcaaatcatttgcagatattaacctttacagggaacagatt aagcgagtaaaagactccgatgacgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggaccgtcgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system