KEGG   Panthera pardus (leopard): 109272373Help
Entry
109272373         CDS       T06062                                 

Gene name
PIGT
Definition
(RefSeq) GPI transamidase component PIG-T isoform X1
  KO
K05292  GPI-anchor transamidase subunit T
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ppad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    109272373 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 109272373
NCBI-ProteinID: XP_019313895
Ensembl: ENSPPRG00000012910
LinkDB All DBs
Position
Unknown
AA seq 588 aa AA seqDB search
MAAALPLVLLVLLLLGPVGRGHAEPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EEVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTV
TDVDKSWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLANAHPRQLESPSGTDHNF
LRYAVLPREVVCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNAR
CTSVSWELRQTLSVVFDAFVTGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITGYNQD
NETLEVTPPPTTTYQDVILGARKTYAVYDLLDTAVINNSRNLNLQLKWKSPPESEAPPVP
FLHAQRYVSGYGLQNGKLNTLLYNTHPHRAFPVLLLDTVPWHLRLYVHTLTITSKGKDNK
PSYVHYQPAQDRLQPHLLEMLIQLPANSATKVSIQFERALLKWTEYTPDPNHGFYVSPSV
ISALVPSTVAAKPVDWEESPLFKSLYPVSDSSSYFVRLYTEPLLVNLPTPDFSMPYNVIC
LTCTVVAVCYGSFYNLLTRTFHIEEPSTGGLAKRLANLIRRARGVPPL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccttgccgctcgtcctgctcgttctgctgctactgggtccggtgggcagg
ggccatgcggaacccccacgcgacagcctgcgggaggagctcgttatcaccccgctgcct
tctggggacgtagccgccacgttccagttccgcacgcgctgggattcggagctgcagcgg
gaagaagtatctcattataggctatttcccaaggccctggggcagttgatctccaaatat
tctctacgagagctgcacttgtcattcacgcaaggcttttggaggactcgatactggggg
ccacctttcctgcaggccccatcaggtgcagagctctgggtctggttccaagacaccgtc
actgacgtggataaatcttggaaggagctcagtaacgtgctctcgggtatcttctgcgcc
tctctgaacttcattgactccaccaacacggtcactcccactgcctccttcaaacccctg
ggactggccaatgcccaccccagacagcttgagtctccctcaggcactgatcacaatttc
ctgcgctacgctgtgctaccgcgagaggttgtctgcactgagaacctcaccccatggaag
aagctcttgccctgcagctccaaggcaggcctgtctgtgctgctcaaggctgaccgcttg
ttccacactagctaccactcccaggcagtgcatatccgtcctgtttgcaggaatgcacgc
tgtaccagcgtctcctgggagctgaggcagaccctttctgttgtgtttgatgccttcgtc
acaggacaggggaagaaagattggtccctctttcggatgttctcccgaaccctgacggag
ccctgccccctggcttcagagagccgagtctatgtggacatcaccggctataaccaggac
aatgagacgttggaggtgacccctcccccaaccaccacctaccaggacgtcatcctcggt
gcccggaagacctacgccgtctacgacttgctggacacggccgtgatcaacaactctcgt
aacctcaacctccagctcaagtggaagagccccccagagagcgaggcccctccggtgccc
ttcctgcatgcccagcggtacgtgagcggctacgggctgcagaacgggaagctgaacacg
ctgctgtacaacacgcacccacaccgggccttccccgtgctgcttctagacaccgtgccc
tggcacctgcggctgtatgtgcacaccctcaccatcacttccaagggcaaggacaacaaa
ccgagttacgtccactaccagcccgcgcaggaccggctgcagccgcacctcctggagatg
ctgattcagctgccggccaactcggccaccaaggtgtccattcagtttgagcgggcgctg
ctcaagtggaccgagtataccccggaccccaaccacggcttctacgtcagcccgtctgtc
atcagtgccctcgtgcccagcacggtggcagccaagcccgtggactgggaagagagcccc
ctgttcaagtccctgtacccggtctccgatagctctagctactttgtgcgcctctacacg
gagccgctgctggtgaacctgcccacgccggacttcagcatgccctacaacgtcatctgc
ctcacgtgcacggtggtggccgtgtgctatggctccttctacaatctcctcacccgaacc
ttccacatcgaggagcccagcacgggcggcctggccaagcggctggctaaccttatccgg
cgtgcccgtggcgtgccgccgctctga

DBGET integrated database retrieval system