KEGG   Panthera pardus (leopard): 109272866
Entry
109272866         CDS       T06062                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00480  Glutathione metabolism
ppad00980  Metabolism of xenobiotics by cytochrome P450
ppad00982  Drug metabolism - cytochrome P450
ppad00983  Drug metabolism - other enzymes
ppad01100  Metabolic pathways
ppad01524  Platinum drug resistance
ppad05200  Pathways in cancer
ppad05204  Chemical carcinogenesis
ppad05225  Hepatocellular carcinoma
ppad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109272866 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109272866 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    109272866 (GSTO1)
   00983 Drug metabolism - other enzymes
    109272866 (GSTO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109272866 (GSTO1)
   05204 Chemical carcinogenesis
    109272866 (GSTO1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109272866 (GSTO1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109272866 (GSTO1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109272866 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppad02000]
    109272866 (GSTO1)
Enzymes [BR:ppad01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109272866 (GSTO1)
Transporters [BR:ppad02000]
 Other transporters
  Pores ion channels [TC:1]
   109272866 (GSTO1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin GST_C_5
Other DBs
NCBI-GeneID: 109272866
NCBI-ProteinID: XP_019314916
Ensembl: ENSPPRG00000022553
LinkDB
Position
Unknown
AA seq 241 aa
MSGGSARSLAKGSAPPGPVPQGLIRVYSMRFCPFAQRTLLVLKAKGIGHEIININLKNKP
EWFFTKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMVFELF
SKVPPLVTSFIRRQNNEDGSGLKEELRKEFSKLEEVLTNKKTTFFGGNSLSMIDYLIWPW
FERLEVLELNECVDHTPKLKLWMAAMREDPAVSSLLIEAKAFRGFLDLYLQNSPEACDYG
L
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtccggagggtcagccaggagcctagcgaagggaagcgcgcccccggggccggtcccc
cagggcctgatccgcgtctacagcatgaggttctgcccgttcgcccagaggacgctcctg
gtcctgaaggccaagggaattgggcatgaaatcatcaacatcaacctgaaaaataagcct
gagtggttctttacgaagaatccctttggtctggtgccagttctggaaaacagtcagggt
caactgatctatgaatctgccattacttgtgagtacctggatgaagcatatccagggaag
aagctgttgccagatgacccctatgagaaagcttgccaaaagatggtctttgagttattt
tctaaggttccccctttggtaacaagcttcattagaagacaaaataacgaagacggctct
ggcctaaaagaagaattgcgtaaagaattcagcaagttagaggaggttctgaccaataag
aagacaaccttctttggtggcaattctctttctatgattgattacctcatctggccctgg
tttgaacggctcgaagttctggagttaaatgagtgtgtagatcacactccaaaacttaag
ctctggatggcagccatgagggaagatcctgcagtgtcctccctcctcattgaggcgaag
gcctttcgaggtttcttagatctctacttgcagaacagccctgaggcctgtgattatggg
ctctga

DBGET integrated database retrieval system