KEGG   Panthera pardus (leopard): 109275230Help
Entry
109275230         CDS       T06062                                 

Gene name
THPO
Definition
(RefSeq) LOW QUALITY PROTEIN: thrombopoietin
  KO
K06854  thrombopoietin
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04060  Cytokine-cytokine receptor interaction
ppad04630  Jak-STAT signaling pathway
ppad04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    109275230 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109275230 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109275230 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ppad04052]
    109275230 (THPO)
Cytokines and growth factors [BR:ppad04052]
 Cytokines
  CSF and other factors
   109275230 (THPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPO_TPO
Motif
Other DBs
NCBI-GeneID: 109275230
NCBI-ProteinID: XP_019318913
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MDPSVQILCVVCVGGRAGLRVDHGPGRGSMFSAGEEKASLPGAFASVWXLPSLIGQKWPG
QACDLLLWRGCAPTLHVFLPICTPEGCLLCTWVLEPFSTRIDSRPSSSAHLCPTVQEVQE
PKPPPWPQEGFRGEAPSREPLQPDSVARMELTEVLLVVMLLLTARLNLCLPAPPACDPRL
LNKLLRDSHVLHSKLSQCPDVNPLSTPVLLPAVDFSLGEWKTQKEQTKAQDVLGAATLLL
EGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPNAIFLSF
QQLLRGKVRFLLIVVGPTLCAKQALPTTAGPSNTSVFLTLHKLPNRTSGFLETDSRVSAR
TTGFGLLKRLQGFRAKIPGRLNQTSRYLDQIPGHVNRTHGPLTGTHGLFPGPSPRALGAP
DILPGTSDMSSLPPDLWPGYSPSPTHPPTGQYTLFSPSPTSPTPPIQLQPPLPDPSVTPS
SASPLLIAPHPHFQNLSQEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggatccctctgttcaaatcctctgtgtggtgtgcgtgggtggaagagctgggctccgc
gtggaccatggtccaggcaggggctccatgttcagtgcgggtgaggagaaggcgtcactt
ccgggggccttcgccagtgtctggtagctcccttctctgattgggcagaagtggcctggg
caggcgtgtgacctactgctgtggaggggctgtgccccaacactacatgtcttcctaccc
atctgcaccccagagggctgcctgctgtgcacctgggtcctggagcccttctccacccgg
atagattccagaccctcttcctcggcccacctgtgccccacagtgcaagaagtgcaagag
cccaagccgcctccatggccccaggaaggattcaggggagaggccccatccagggagcca
ctccaaccagacagcgtggccagaatggagctgactgaagtgctcctcgtggtcatgctt
ctcctaactgcaagactgaatctatgccttccggctcctccagcctgtgacccccgtctc
ctaaataaactgcttcgtgattcccatgtccttcacagcaaattgagccagtgcccagac
gttaaccctttgtccacacctgtcctgctgcctgctgtggactttagcctgggagaatgg
aaaacccagaaggagcagaccaaggcacaggacgttctgggagccgcgacccttctgctg
gagggagtaatggcagcacggggacaactgggacccacctgcctctcatccctcctggga
cagctttctggacaggtccgcctcctccttggggccctgcagggcctcctaggaacccag
cttcctccacagggcaggaccacagctcacaaggatcccaatgccatattcctgagcttc
caacaactgctccgaggaaaggtgcgtttcctgctgattgtagtagggcccactctctgt
gccaagcaggccctgcccactacagctggcccaagcaatacctctgtattcctcacacta
cacaagctcccaaacaggacttctggatttttggagacagactcccgtgtctcagccaga
actactggctttggacttctgaagaggctgcagggattcagagccaagattcctggtcgg
ctgaaccaaacctccaggtacctagaccaaatccctggacacgtgaacaggacacacgga
cccttgactggaactcatggactctttcccggaccctcacccagggctctaggagcccca
gacatccttccaggaacttcagacatgagctccctgccacccgacctctggcctggatat
tctccttccccaacccatcctcctactgggcaatacacactcttctctccttcacccacc
tcacccactcccccgatccagctccagcctccacttcctgacccctctgtcacacccagc
tctgccagtcctcttctaattgcaccccaccctcacttccagaatctgtctcaggaggag
taa

DBGET integrated database retrieval system