KEGG   Panthera pardus (leopard): 109276255
Entry
109276255         CDS       T06062                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04010  MAPK signaling pathway
ppad04020  Calcium signaling pathway
ppad04022  cGMP-PKG signaling pathway
ppad04024  cAMP signaling pathway
ppad04260  Cardiac muscle contraction
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04270  Vascular smooth muscle contraction
ppad04713  Circadian entrainment
ppad04720  Long-term potentiation
ppad04723  Retrograde endocannabinoid signaling
ppad04724  Glutamatergic synapse
ppad04725  Cholinergic synapse
ppad04726  Serotonergic synapse
ppad04727  GABAergic synapse
ppad04728  Dopaminergic synapse
ppad04742  Taste transduction
ppad04911  Insulin secretion
ppad04912  GnRH signaling pathway
ppad04921  Oxytocin signaling pathway
ppad04924  Renin secretion
ppad04925  Aldosterone synthesis and secretion
ppad04927  Cortisol synthesis and secretion
ppad04929  GnRH secretion
ppad04930  Type II diabetes mellitus
ppad04934  Cushing syndrome
ppad04935  Growth hormone synthesis, secretion and action
ppad05010  Alzheimer disease
ppad05020  Prion disease
ppad05022  Pathways of neurodegeneration - multiple diseases
ppad05031  Amphetamine addiction
ppad05410  Hypertrophic cardiomyopathy
ppad05412  Arrhythmogenic right ventricular cardiomyopathy
ppad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109276255 (CACNA1C)
   04020 Calcium signaling pathway
    109276255 (CACNA1C)
   04024 cAMP signaling pathway
    109276255 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    109276255 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109276255 (CACNA1C)
   04929 GnRH secretion
    109276255 (CACNA1C)
   04912 GnRH signaling pathway
    109276255 (CACNA1C)
   04921 Oxytocin signaling pathway
    109276255 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    109276255 (CACNA1C)
   04924 Renin secretion
    109276255 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    109276255 (CACNA1C)
   04927 Cortisol synthesis and secretion
    109276255 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109276255 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    109276255 (CACNA1C)
   04270 Vascular smooth muscle contraction
    109276255 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    109276255 (CACNA1C)
   04727 GABAergic synapse
    109276255 (CACNA1C)
   04725 Cholinergic synapse
    109276255 (CACNA1C)
   04728 Dopaminergic synapse
    109276255 (CACNA1C)
   04726 Serotonergic synapse
    109276255 (CACNA1C)
   04720 Long-term potentiation
    109276255 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    109276255 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    109276255 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109276255 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109276255 (CACNA1C)
   05020 Prion disease
    109276255 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    109276255 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    109276255 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109276255 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109276255 (CACNA1C)
   05414 Dilated cardiomyopathy
    109276255 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109276255 (CACNA1C)
   04934 Cushing syndrome
    109276255 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ppad04040]
    109276255 (CACNA1C)
Ion channels [BR:ppad04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109276255 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 109276255
NCBI-ProteinID: XP_019320523
Ensembl: ENSPPRG00000024182
LinkDB
Position
Unknown
AA seq 2255 aa
MLRAFVQPAAPAYQPLPRHPPAESEVKFKGTLVHEAQLNRFYIPPGGSNYGSPRAAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTISSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNRSTPAGLLDQKKGKFSWFSHSTETHVSMPTSETESVNTENVAGGDIE
GENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEH
YNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETIL
VETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIF
SLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFP
GMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARPARTA
SPEKKQEIMEKPAVEETKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPYPNPEN
TGEDDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIF
TNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNADYVFTS
IFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRV
LRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSS
KQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLY
RSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCEL
DKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYG
QSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSE
TNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFRVM
RLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEIN
RNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVF
YFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKH
LDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKT
EGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKR
KEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDD
IFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGNSQGDTESPSHEKLVDSTFT
PSSYSSTGSNANINNANNTALGRFPRPAGYPSAVSTVEGHGPPLSPAVRVQEAAWKLSSK
RIHCYDVLGRCHSRESQIAMVCQEEVSQDETYDVKISEDTEYCSEPSLISTEMLSYQDDE
NRQLTPPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKNQGGDISQKTVLPLHLV
HHQALAVAGLSPLLQRSHSPSTSPRPCATPPATPGSRGWPPQPIPTLRLEGAESSEKLNS
SFPSIHCSSWSGEPTPCGGGGSTIRRARPVSLTVPGQAGAQGRQFHGSASSLVEAVLISE
GLGQFAQDPKFIEVTTQELADACDMTIEEMENAADNILSGGAQQSPNGTLLPFVNCRDPG
QDRAEGQEGETCAPTLACRKSEEELQDSRAHVGSL
NT seq 6768 nt   +upstreamnt  +downstreamnt
atgcttcgagcctttgttcagcctgctgcgcctgcataccagccgcttcccaggcaccct
cctgccgagtcagaggtgaagtttaagggcactttggtgcatgaagctcaactcaaccgt
ttctacatccctcctggaggttccaactatgggagcccgcgcgcagctcacgccaacatg
aatgccaatgcggctgcggggctcgcccccgagcacatcccaacgcccggggcagccttg
tcctggcaggcagccatcgacgcggcccggcaggctaagctgatgggcagcgctggcaat
gcaaccatctccaccatcagctccacacagcggaagcggcagcaatatgggaaacccaag
aagcagggcagcacgaccgccacacgcccgccccgcgccctgctctgcctgactctgaag
aaccccatcaggagggcgtgcatcagcatcgtcgaatggaaaccatttgaaataattatt
ttactgactatttttgccaattgtgtggccttagcgatctatattccctttccagaagat
gactccaatgccaccaattccaacctggaacgagtggaatatctctttctcataattttt
actgtggaagcatttttaaaagtaatagcctatggacttctctttcaccccaacgcttac
ctccgcaatggctggaatttactagattttataattgtggttgtagggctttttagtgca
attttagaacaagccaccaaagccgacggggcaaatgctctaggagggaaaggagctgga
tttgatgtgaaggcactgagggcattccgcgtgctgcgccccttgcggctggtgtctgga
gtcccaagtctccaagtcgttctgaattccattatcaaggccatggtccccctgctgcat
attgccctgttagtgctatttgtcatcatcatctacgctatcattggcctggagctcttc
atgggaaagatgcataagacctgctacaaccaggagggcatagcagatgttccagcagaa
gatgatccttccccttgtgctctggagactggccatgggcggcagtgccagaatggcact
gtgtgcaagcctggctgggacgggcccaagcacggcatcaccaactttgacaattttgcc
ttcgccatgttgacagtgttccagtgcatcaccatggagggctggacagatgtgctatac
tggatgcaggacgctatgggctatgagttaccctgggtgtattttgtcagtctggtcatc
tttggatcctttttcgttctaaatctggttctcggtgtgttgagcggagagttttccaaa
gagagagagaaggccaaggctcggggagacttccagaagctgcgagagaagcagcagctg
gaagaggacctgaagggctacctggactggatcacccaggcagaggacatcgaccctgag
aacgaggatgaaggcatggatgaggagaagccccgaaacagaagcactccagcgggcttg
cttgatcagaagaaagggaagttttcttggtttagtcactccacagaaacccatgtgagc
atgcccacaagtgagaccgagtctgtcaacaccgaaaacgtggctggaggtgacatcgag
ggagagaactgcggggccaggctggcccatcggatttccaaatcaaagttcagccgctac
tggcgtcggtggaatcggttctgcagaagaaagtgtcgtgctgcagtcaagtctaatgtc
ttctactggcttgtgatcttcctggtgttcctcaacacactcaccatcgcctcagaacat
tacaaccagccccattggctcacggaggtccaagacacggccaacaaggcactactggcc
cttttcactgcggagatgctgctaaagatgtacagcctgggcctgcaggcctactttgtg
tccctcttcaaccgctttgactgcttcatcgtgtgtgggggcattctggagaccatcctg
gtggagaccaagatcatgtctcccttgggcatctctgtactgagatgtgtccggctactg
cggatatttaaaatcacaaggtactggaactccttaagcaacctggtggcatccttgctg
aattctgtgcgctccattgcctccctgctgctactcctcttcctcttcatcatcatcttc
tccctcctggggatgcagctctttggaggaaagttcaactttgatgagatgcagactcgg
aggagcacatttgataactttcctcagtccctcctcaccgtgtttcagatcctgaccggg
gaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccctcttttcca
gggatgttagtctgtatttacttcatcatcctcttcatctgtggaaactatatcctactg
aatgtgttcttggccattgctgtggacaacctggctgatgctgagagcctcacatctgcc
caaaaggaggaggaagaagagaaggagagaaagaagctggccagaccggccaggactgcc
agcccagagaaaaagcaagagataatggaaaagccagctgtggaggaaactaaggaggag
aaaattgagctgaaatccattacagctgatggagagtccccacccaccaccaagatcaac
atggatgacctccagcccaatgaaaatgaagataagagtccctaccccaacccagaaaat
acaggagaagacgatgaagaggagcctgagatgcctgtgggcccccgcccacgaccactc
tctgagctgcaccttaaggaaaaggcagtgcccatgccagaagccagtgcatttttcatc
ttcagccccaacaacagatttcgcctccagtgccaccgcattgtcaatgacacgatcttc
accaacctgatcctcttcttcattctgctcagcagcatttccctggcagctgaggaccct
gtccagcacacctccttcaggaaccatattctgttttattttgacattgttttcactacc
attttcaccattgaaattgctctgaagatcctaggcaatgcagactatgtcttcactagt
atctttacattagaaattatccttaagatgactgcttatggggctttcctacacaagggc
tctttctgccggaactacttcaacatcttggacctgctggtggtcagcgtgtccctcatc
tcctttggcatccagtccagtgcaattaatgtggtgaagatcttgcgagttctgcgggtc
ctcaggcccctgagggccatcaacagggccaaggggctaaagcacgtggtccagtgcgtg
tttgtcgccatccggaccatagggaatatcgtgattgtcaccacgctgctccagttcatg
ttcgcctgcatcggggtccagcttttcaagggaaagctctacacctgttcagatagttcc
aagcagaccgaggcggaatgcaagggtaactacatcacatacaaggatggggaagttgac
caccccatcatccagcctcgcagctgggaaaacagcaagtttgactttgacaatgttctg
gcagccatgatggcgctctttaccgtctccacttttgaggggtggccagagctgctgtac
cgctccatcgactcccacacagaagacaagggccccatctacaactaccgtgtggagatc
tccatctttttcatcatctacatcatcatcattgccttcttcatgatgaacatcttcgtg
ggttttgtcatcgtcaccttccaggagcagggggagcaggaatacaagaactgtgaactg
gacaagaaccagcgacagtgtgtggaatatgccctcaaggcccggcccctgcggaggtac
atccccaaaaaccagcaccagtacaaagtgtggtatgtggtcaactccacctactttgaa
tacctgatgtttgtcctcatcctgctcaacaccatctgcttggcaatgcagcactatggc
cagagctgcctattcaaaatcgccatgaacatcctcaacatgctcttcactggcctcttc
actgtggagatgattctgaagctcattgccttcaaacccaagggttactttagtgatccc
tggaatgtttttgacttcctcatcgtaattggcagcataattgacgtcattctcagtgaa
actaatcactatttctgtgatgcatggaatacatttgacgccttgattgttgtgggtagc
attgttgatatagcaatcaccgaggtaaacccagctgaacatacccaatgctctcccttt
atgaacgcagaggagaactcccgcatctccatcaccttcttccgcctcttccgggtcatg
cgcctggtcaagctgctaagccgtggggagggcatccggaccctgctgtggaccttcatc
aagtccttccaggctttgccctatgtggcccttctgatagtgatgctgttcttcatctac
gcagtgatcgggatgcaggtgtttgggaaaattgccctgaatgacaccacagagatcaac
cggaacaacaactttcagaccttcccccaagctgtgctccttctcttcaggtgtgccaca
ggggaggcatggcaagacatcatgctggcctgcatgccagggaagaagtgtgcccccgag
tcagagcccagcaacagcacggaaggggaaacgccctgtggcagcagttttgccgtcttc
tacttcatcagcttctacatgctctgtgccttcctgatcatcaacctctttgtagctgtc
atcatggacaactttgactacctgacaagagactggtcaatccttggtccccatcatctg
gatgaatttaaaagaatctgggcagagtatgatcctgaagctaagggtcgtatcaaacac
ctagatgtggtgaccctgctccggcggattcagcccccactgggttttgggaagctgtgc
cctcaccgcgtggcttgcaaacgcctggtctccatgaacatgcctctgaacagtgatggg
actgtcatgttcaatgccaccctgtttgccctagtccggacagccctgcggatcaaaaca
gaagggaacctagaacaagccaatgaggagctgcgagccataatcaagaagatctggaag
cgtaccagcatgaagctgctagaccaagtggtgccccctgcaggtgatgatgaggtcacc
gttggcaagttttatgctactttcctgatccaagagtacttccggaaattcaagaagcgc
aaagagcagggccttgtgggcaagccttcccaaaggaacgccctgtccttgcaggctggc
ttgcgcacgctgcatgacattgggcctgagatccgacgggccatctctggagatctgaca
gctgaggaggagctggacaaggccatgaaggaggctgtgtctgctgcctccgaagatgac
atcttcaggagggccggtggcctgttcggcaaccacgtcagctactaccaaagcgacggc
cggagcgccttcccccagaccttcaccacccagcgcccactgcacatcaacaaggcgggt
aacagccaaggcgacaccgagtcgccatcccacgagaaactggtggactccaccttcacc
cccagcagctactcgtccactggctccaacgccaacatcaacaatgccaacaacactgcc
ctgggccgcttcccccgtcccgctggctaccccagcgcagtcagcaccgtggagggccat
gggccccccttgtctcctgctgtccgggtacaggaggcagcatggaagctcagctccaag
aggatacattgctatgatgtgctgggacggtgccactcccgggagagccagatagccatg
gtgtgtcaggaggaggtctctcaggacgagacctatgacgtgaagataagtgaagacact
gagtactgcagcgagcccagcctgatctccacagagatgctctcctatcaggatgatgaa
aatcggcaattaacaccaccggaggaggacaagagagatatccggcaatctccaaagagg
ggcttcctccgctctgcctcactaggtcgaagggcctccttccacctggaatgtctgaag
cgacagaagaatcaagggggagacatctctcagaagacagtcctgcccttgcatctggtt
catcatcaggcattggcggtggcaggcctgagccccctcctccagagaagccattccccc
agcacatcccccaggccctgtgccaccccaccagccactccaggcagccgaggctggccc
ccacagcctatccccaccctgcggctggagggtgccgaatccagcgagaaactcaacagc
agcttcccgtccatccactgcagctcctggtctggggagcccacaccctgtggtggaggt
ggcagcaccatccggagagcccggccagtgtccctcactgtacctggccaggctggggcc
cagggcaggcagttccacggcagtgccagcagcctggtagaagcggtcttgatttcagaa
ggactggggcagtttgctcaagatcccaagtttattgaggtcacaacccaggagctggct
gacgcctgtgacatgaccatagaggagatggagaacgccgcagacaacatcctcagtggg
ggcgcccagcagagccccaatggcaccctactacctttcgttaactgcagggacccaggg
caggacagagcagagggccaagagggcgagacctgcgcgcccaccctggcgtgtcggaag
agcgaggaggagctccaggacagcagagcccacgtcggcagcctgtag

DBGET integrated database retrieval system