KEGG   Panthera pardus (leopard): 109276279
Entry
109276279         CDS       T06062                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad01524  Platinum drug resistance
ppad04071  Sphingolipid signaling pathway
ppad04115  p53 signaling pathway
ppad04210  Apoptosis
ppad04215  Apoptosis - multiple species
ppad04217  Necroptosis
ppad04650  Natural killer cell mediated cytotoxicity
ppad04932  Non-alcoholic fatty liver disease
ppad05010  Alzheimer disease
ppad05014  Amyotrophic lateral sclerosis
ppad05022  Pathways of neurodegeneration - multiple diseases
ppad05152  Tuberculosis
ppad05160  Hepatitis C
ppad05161  Hepatitis B
ppad05162  Measles
ppad05163  Human cytomegalovirus infection
ppad05164  Influenza A
ppad05167  Kaposi sarcoma-associated herpesvirus infection
ppad05168  Herpes simplex virus 1 infection
ppad05169  Epstein-Barr virus infection
ppad05170  Human immunodeficiency virus 1 infection
ppad05200  Pathways in cancer
ppad05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    109276279 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109276279 (BID)
   04215 Apoptosis - multiple species
    109276279 (BID)
   04217 Necroptosis
    109276279 (BID)
   04115 p53 signaling pathway
    109276279 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109276279 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109276279 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109276279 (BID)
   05014 Amyotrophic lateral sclerosis
    109276279 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    109276279 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109276279 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109276279 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109276279 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109276279 (BID)
   05161 Hepatitis B
    109276279 (BID)
   05160 Hepatitis C
    109276279 (BID)
   05164 Influenza A
    109276279 (BID)
   05162 Measles
    109276279 (BID)
   05168 Herpes simplex virus 1 infection
    109276279 (BID)
   05163 Human cytomegalovirus infection
    109276279 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109276279 (BID)
   05169 Epstein-Barr virus infection
    109276279 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109276279 (BID)
SSDB
Motif
Pfam: BID Bcl-2 DUF5631 DUF1002 bcl-2I13 INTS5_N
Other DBs
NCBI-GeneID: 109276279
NCBI-ProteinID: XP_019320618
Ensembl: ENSPPRG00000004108
UniProt: A0A6P4XUX0
LinkDB
Position
Unknown
AA seq 196 aa
MDSQVSNGSSLQDERITNLLVFGFLQNCSNYNFHKELEVLGRELPVPPAYLQEDHDDGLQ
TDGNRCSRFLDSEETDSESQEEIIQDIARQLAQIGDRMDHSIHPRVVNNLAMQFMNVNLS
EEDRRKHLAAALEQVLQTYPKDMEMEKTVLLLAMVLAKKVADHTPSLLRDVFRTTVNFIN
QNLLTYVRNLVRNEMD
NT seq 591 nt   +upstreamnt  +downstreamnt
atggattctcaggtcagcaatggttcaagcctccaggatgagcgcatcacaaacttgctg
gtgtttggcttcctccaaaactgctccaactataatttccataaagagttagaagtgttg
ggccgtgaactgcctgtgccaccagcttacctgcaggaggaccacgatgatgggctccag
acagatggcaaccggtgcagccgcttcctggatagcgaggagacagattctgagagtcaa
gaggaaatcatccaagatatcgccaggcagctcgcccaaatcggggataggatggatcac
agcatccacccaagagtggtgaataacctggcaatgcagtttatgaatgtgaacctgtca
gaagaagacagaaggaagcaccttgctgctgcgctggagcaggtcctacagacttacccg
aaggacatggagatggagaagaccgtgctcctgttggccatggtattggccaaaaaggtg
gccgatcacacaccgtccttgctccgtgatgtctttcgcacaacagtgaactttattaac
cagaacttactcacgtatgtgaggaacttagtcagaaatgagatggactga

DBGET integrated database retrieval system