KEGG   Panthera pardus (leopard): 109278988
Entry
109278988         CDS       T06062                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad01521  EGFR tyrosine kinase inhibitor resistance
ppad04010  MAPK signaling pathway
ppad04014  Ras signaling pathway
ppad04015  Rap1 signaling pathway
ppad04020  Calcium signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04144  Endocytosis
ppad04151  PI3K-Akt signaling pathway
ppad04510  Focal adhesion
ppad04540  Gap junction
ppad04630  JAK-STAT signaling pathway
ppad04810  Regulation of actin cytoskeleton
ppad05163  Human cytomegalovirus infection
ppad05200  Pathways in cancer
ppad05206  MicroRNAs in cancer
ppad05214  Glioma
ppad05215  Prostate cancer
ppad05218  Melanoma
ppad05230  Central carbon metabolism in cancer
ppad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109278988 (PDGFRA)
   04014 Ras signaling pathway
    109278988 (PDGFRA)
   04015 Rap1 signaling pathway
    109278988 (PDGFRA)
   04630 JAK-STAT signaling pathway
    109278988 (PDGFRA)
   04020 Calcium signaling pathway
    109278988 (PDGFRA)
   04072 Phospholipase D signaling pathway
    109278988 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    109278988 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109278988 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109278988 (PDGFRA)
   04540 Gap junction
    109278988 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109278988 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109278988 (PDGFRA)
   05206 MicroRNAs in cancer
    109278988 (PDGFRA)
   05230 Central carbon metabolism in cancer
    109278988 (PDGFRA)
   05231 Choline metabolism in cancer
    109278988 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    109278988 (PDGFRA)
   05218 Melanoma
    109278988 (PDGFRA)
   05215 Prostate cancer
    109278988 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109278988 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109278988 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppad01001]
    109278988 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ppad04090]
    109278988 (PDGFRA)
Enzymes [BR:ppad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109278988 (PDGFRA)
Protein kinases [BR:ppad01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109278988 (PDGFRA)
CD molecules [BR:ppad04090]
 Proteins
  109278988 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 109278988
NCBI-ProteinID: XP_019325259
Ensembl: ENSPPRG00000004078
LinkDB
Position
Unknown
AA seq 1089 aa
MGTSHPALLVLVCLLTGPSLISCQLSLPSILPNENEKVVQLNSSFSLQCFGESEVSWQYP
MSEEENPNVEVRNEENNSGLFVTVLEVVNASAAHTGLYTCYYNHTQTDENEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPKTPVTLRSSDGVVHASYDSRQGFNG
TFSVGPYICEATVSGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCSNETSWTVLANNISNIITEVHRRD
RSTVEGRVTFTRVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSTSDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKNGYRMAKPDHATSEVYEIMVKCWHSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKHEEDKLKDWEGSLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFVKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccacccggcgctcctggtgttagtctgtctcctcacaggaccgagccta
atctcctgccagctttcattaccctctatccttccaaacgaaaatgaaaaggtcgtgcag
ctgaattcctccttttctctgcaatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaagtcagaaatgaagaaaacaacagtggcctt
tttgtgacggtgctggaagtggtcaatgcgtcggcggcccacacgggactgtacacttgc
tattacaaccacactcagacggacgaaaacgagatcgaaggcaggcgcatttacatctat
gtcccagacccagacgtagccttcgtacctctaggaatgacagattatttagttatcgtg
gaggacgatgactctgccatcataccttgtcgcacaactgatcccaagactccggttacc
ttacgcagcagtgacggggtggtacacgcctcctatgacagcagacagggctttaatggg
accttcagcgtcgggccctatatctgcgaagccacagtcagcgggaagaagttccagacc
atcccatttaatgtttatgctttaaaagcaacatcagaacttgatctagaaatggaagct
ctcaaaactgtgtataagtcaggggagacgattgtggtcacctgtgccgtctttaacaac
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacgatg
ctggaggagatcaaggtcccgtccatcaaactggtttacacgctgacggtccccgaggcc
acggtgaaggatagtggagattatgaatgtgctgcccgccaggccaccaaggaggtcaaa
gagatgaagaaagtcaccatttccgtccatgagaaagggttcattgaaatcaaacccaac
ttcagcccgttggaggctgttgacctgcatgaagtcaaacatttcgtggtggatgtgcag
gcctacccccctcccaggatatcctggctgaaggacaacctgactctgattgaaaatctc
acggagatcaccactgacatagaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgtgcgaaggaagaagacagcggccattacactattgtcgtccaaaatgaagac
gacgtgaagagctatactttcgaactcttaacgcaagttccctcgtctattctggacttg
gtcgacgaccaccatggctccaccgggggacagactgtgagatgcacagcagaagggaca
cctcttcccgatatcgagtggatgatttgcaaggatattaagaaatgtagtaacgaaact
tcatggacggttttggcgaacaacatctcgaacatcatcacggaggtccaccgccgggac
aggagtactgtggagggccgagtgacgttcaccagagtggaggagaccatcgccgttcga
tgcctggccaagaatcttcttggagccgagaaccgagagctgaagctggtggctcccacg
ctgcgttctgaactcacagtggcagctgcagtcctggtcctgctggtgattgtgatcatc
tccctcattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgttggagg
gtcattgaatcgatcagccccgatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactctagatgggagtttccgagagatggactagtgcttggtcgtatcctggga
tctggtgcgttcgggaaagtggtcgaaggaactgcctatggattgagccggtcccagcct
gtcatgaaagtagcagtaaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtcagaactgaagataatgactcatctggggccccatttaaacattgtgaacttg
ctgggggcctgcaccaagtcaggccctatttacatcatcacggagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccgacacccagagaag
ccaaagaaagagttggacatttttgggctgaaccctgctgatgaaagcacacggagttat
gttattttatcttttgaaaacaatggtgactatatggacatgaagcaagctgataccaca
cagtatgtccccatgctggaaaggaaagaggtttctaaatactcggacatccagagatcg
ctgtatgatcgcccggcctcgtataagaagaaatctacgtcagactcggaagtcaaaaac
ctcctttcggacgataactcagaaggcctgactctgctggatttgttgagctttacctat
caagtggcgcgagggatggaatttttggcttccaaaaattgtgtccaccgggacctggct
gctcgcaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgacttcggcctggcc
agggacatcatgcatgattcaaactacgtgtccaaaggcagcacctttctccccgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtct
tacggcattctgctctgggagatcttttcccttgggggcaccccgtaccctggtatgatg
gtggattccactttctacaacaagatcaagaatgggtaccggatggccaagcctgaccac
gccaccagcgaagtctatgaaatcatggtcaagtgctggcacagtgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgttgccgggacaatataagaag
agctatgaaaagattcacctggacttcttgaagagcgaccaccctgccgtggcgcgcatg
cgcgtggactcggacaacgcctacatcggtgtcacctacaaacacgaggaagacaagctg
aaggactgggaaggcagcctggacgagcagaggctgagtgcagacagcggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctcagaagagagcgccattgagacaggttccagcagctctaccttcgtc
aagagagaggatgaaaccatcgaggacatcgacatgatggatgacattggcatagactcc
tcagacctggtagaggacagcttcctgtga

DBGET integrated database retrieval system