KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_03175Help
Entry
A8F97_03175       CDS       T04513                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Pathway
ppar00020  Citrate cycle (TCA cycle)
ppar00190  Oxidative phosphorylation
ppar00650  Butanoate metabolism
ppar01100  Metabolic pathways
ppar01110  Biosynthesis of secondary metabolites
ppar01120  Microbial metabolism in diverse environments
ppar01130  Biosynthesis of antibiotics
ppar01200  Carbon metabolism
Module
ppar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppar_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A8F97_03175
   00650 Butanoate metabolism
    A8F97_03175
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A8F97_03175
Enzymes [BR:ppar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A8F97_03175
    1.3.5.4  fumarate reductase (quinol)
     A8F97_03175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AOR57910
UniProt: A0A0H3I6J7
LinkDB All DBs
Position
735254..735970
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDDAPRMQDYQLEAEEGRDMMLLDALMLLKEQDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPVSALQRGKSKIVIRPLPGLPVVRDLVVDMGQFYAQYEKIKPY
LLNNGKNPPAREHLQSPEQRAKLDGLYECIMCACCSTSCPSFWWNPDKFVGPAGLLAAYR
FLIDSRDTETTPRLDDLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLLHRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaattttccatttatcgttacaacccggatgttgacgatgcgccgcggatg
caggattaccagttggaggcggaagaaggccgcgacatgatgctgctggatgcgctgatg
ctgctgaaagaacaagatccaacgctttcattccgtcgctcctgccgtgaaggtgtctgt
ggctccgacggcgttaacatgaacggcaaaaatggcttggcctgtattacgccggtttcc
gcgttacagcgcggaaagagcaaaattgttatccgtcctttaccgggattgccggttgtg
cgtgatttggtagtggacatgggacagttctatgctcaatatgagaaaataaagccttac
ctgttgaataatgggaaaaatccaccagcgcgtgagcatctgcaatcgcctgaacaacgt
gccaagctggatgggttgtatgaatgtattatgtgtgcatgctgttcaacgtcttgcccg
tcgttctggtggaacccagacaagtttgttgggcctgcggggctgctggctgcgtaccgt
ttcctgattgacagtcgtgatacggaaactacgccacggttggacgatctggacgatgca
tttagcgttttccgctgccacggtatcatgaactgcgtcagcgtctgtccgaaaggactg
aacccgactaaggctatcggccatattaaatcgatgttactgcaccgcagcgcgtaa

DBGET integrated database retrieval system