KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_03320Help
Entry
A8F97_03320       CDS       T04513                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Pathway
ppar00010  Glycolysis / Gluconeogenesis
ppar00260  Glycine, serine and threonine metabolism
ppar00680  Methane metabolism
ppar01100  Metabolic pathways
ppar01110  Biosynthesis of secondary metabolites
ppar01120  Microbial metabolism in diverse environments
ppar01130  Biosynthesis of antibiotics
ppar01200  Carbon metabolism
ppar01230  Biosynthesis of amino acids
Module
ppar_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ppar_M00002  Glycolysis, core module involving three-carbon compounds
ppar_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A8F97_03320 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    A8F97_03320 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A8F97_03320 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppar04131]
    A8F97_03320 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppar04147]
    A8F97_03320 (gpmA)
Enzymes [BR:ppar01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     A8F97_03320 (gpmA)
Membrane trafficking [BR:ppar04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    A8F97_03320 (gpmA)
Exosome [BR:ppar04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   A8F97_03320 (gpmA)
  Exosomal proteins of melanoma cells
   A8F97_03320 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AOR57936
UniProt: A0A0H3I8E6
LinkDB All DBs
Position
complement(762073..762825)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSDKGRSEAKAAGQLLKDEGFAFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
ITPPELTRDDERFPGHDPRYAALSDKELPLTESLALTIERVVPYWTETILPRIKSGERVI
VAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctagtactggtaagacacggtgagagccagtggaacaacgaaaac
cgcttcacaggctggtacgatgttgatctgtccgacaagggccgttcagaagccaaagcc
gcaggtcaactgctgaaagacgaaggttttgcctttgatttcgcgtatacctccgtgctg
aaacgtgccattcatacactgtggaacgtactggacgagctggatcaagcctggttgcca
gttgagaaatcctggaaactgaacgagcgccattacggtgcgctgcagggtctgaacaaa
gccgaaaccgctgaaaaatacggtgacgagcaggttaaacaatggcgtcgtggtttcgcc
atcacgcctccagagttgacgcgtgatgacgaacgttttccaggccacgatccacgttat
gcagcgctgagtgacaaagagctaccgctgactgaaagcctggctctgaccatcgaacgc
gttgtgccttactggaccgaaaccatcctgccacgcatcaagagcggtgagcgtgtgatc
gttgcggctcacggtaactcgttgcgtgccctggtgaaatacctggacaacatgggtgaa
gacgaaattctggaactgaatatcccaactggcgtaccgttggtgtatgagttcgacgag
aacttcaaaccaatcaaacgttactatctgggcaacgcggatgaaatcgccgcaaaagct
gccgcagtagcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system