KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_17360Help
Entry
A8F97_17360       CDS       T04513                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Brite
KEGG Orthology (KO) [BR:ppar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ppar03012]
    A8F97_17360
   03029 Mitochondrial biogenesis [BR:ppar03029]
    A8F97_17360
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppar04147]
    A8F97_17360
Translation factors [BR:ppar03012]
 Eukaryotic Type
  Elongation factors
   A8F97_17360
 Prokaryotic Type
   A8F97_17360
Mitochondrial biogenesis [BR:ppar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A8F97_17360
Exosome [BR:ppar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A8F97_17360
  Exosomal proteins of breast cancer cells
   A8F97_17360
  Exosomal proteins of colorectal cancer cells
   A8F97_17360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: AOR60647
UniProt: A0A0H3HYC9
LinkDB All DBs
Position
complement(3829815..3830999)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GEAEWEAKIVELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgttctggctaaaacctac
ggtggtaacgcacgtgcattcgaccagatcgataacgcaccagaagaaaaagcacgtggt
atcaccatcaacacgtctcacgttgaatacgataccccgtctcgccactacgcgcacgtt
gactgcccaggacacgccgactatgtgaaaaacatgatcaccggtgctgcccagatggat
ggcgcgatcctggttgttgctgcaaccgacggcccaatgcctcagactcgtgagcacatc
ctgctgggtcgtcaggttggcgttcctttcatcatcgtgttcctgaacaaatgtgacatg
gttgatgacgaagaactgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgacttcccaggcgacgacacgccggtaattcgtggttcagcgctgaaagcgctggaa
ggcgaagctgagtgggaagctaaaatcgtcgaactggcaggctacctggattcttatatt
ccagaaccagagcgtgcaattgacaagccgttcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtactgttgttaccggtcgtgtagagcgcggtattgttaaagtcggt
gaagaagttgaaatcgttggtatcaaagatacggcgaaatcgacctgtactggcgtagaa
atgttccgcaaattgctggacgaaggtcgtgcaggggagaacgttggtgttctgctgcgt
ggtatcaagcgtgaagaaatcgagcgtggccaggtactggctaagccgggttcaatcaag
ccgcacacccagtttgaatcagaagtgtatatcctgagcaaagatgaaggcggtcgtcat
actccgttcttcaaaggctaccgtcctcagttctacttccgtaccactgacgtaacgggt
accatcgaactgccagaaggcgtagagatggtcatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccaatcgcgatggatgacggtttgcgtttcgcaatccgtgaaggc
ggccgtactgtaggcgcgggcgttgttgctaaagttatcgcttaa

DBGET integrated database retrieval system