KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_19245Help
Entry
A8F97_19245       CDS       T04513                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Brite
Enzymes [BR:ppar01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A8F97_19245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AOR61007
UniProt: A0A0H3IEY8
LinkDB All DBs
Position
complement(4254035..4254661)
Genome map
AA seq 208 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKETMEIHHSKHHQAYVNNANAALESLPELAKLSVEELIAQ
LDKVPAEKKAALRNNAGGHANHSLFWKGLKLGTTLAGDLKAAIERDFGSVDAFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGTSGYPIVGLDVWEHAYYLKFQ
NRRPDYAKAFWNVLNWDEAAARFAGAKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcgctgccttatgcttatgacgcactggaaccgcatttcgac
aaagaaacgatggaaattcaccattccaaacaccatcaggcttacgtcaataatgctaat
gccgcgctggaatccctgcctgagctggctaaattatcggttgaagagctgattgctcaa
ctggataaggtccctgccgagaaaaaagcagcactgcgtaacaacgctggcggccacgct
aaccacagcctgttttggaaaggcctgaaattaggcactacgctggctggcgatctgaaa
gcagcaatcgaacgcgatttcggcagcgttgatgcgtttaaagagaaatttgagcaagca
gcagcaacccgctttggctctggctgggcttggctggttctgaaagacgacggcaagctg
gctgtggtttctaccgcaaaccaagacagtccgctgatgggtgaagcgatttctggtacc
tctggctacccaatcgtcggtctggacgtatgggaacacgcttactacctgaaattccaa
aaccgtcgcccagattacgctaaagcattctggaacgtgctgaactgggacgaagctgcg
gctcgtttcgctggcgcgaaaaaataa

DBGET integrated database retrieval system