KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_19610Help
Entry
A8F97_19610       CDS       T04513                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Pathway
ppar00260  Glycine, serine and threonine metabolism
ppar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A8F97_19610
Enzymes [BR:ppar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     A8F97_19610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 FAD_binding_2 HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AOR61078
UniProt: A0A3Q9JYV6
LinkDB All DBs
Position
4330931..4331962
Genome map
AA seq 343 aa AA seqDB search
MKVLAKLRPEEGIWMMDAPMPELGHNDIMIKIRKSAICGTDVHIYNWDEWSQKTIPVPMV
VGHEYVGEVVAIGQEVNGFHIGDRVSGEGHITCGYCRNCRAGRRHLCRNAIGVGVNRPGS
FAEYLVIPAYNAFRIPDNIPDELAAIFDPFGNAVHTALSFDLVGEDVLIAGAGPIGMMAV
AVCRHAGARNVVITDVNAYRLELASKMGATRVVNVAEEKLSDVMIELGMTEGFDIGLEMS
GAPSAFRAMLKAMNHGGRIAMLGIPHEPMSIDWGEVIFKGLFIKGIYGREMFETWYKMSA
LIQSGLDLSPIITHRFHIDEFQKGFDAMRSGQSGKVILSWDET
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtactggcaaaactgcggccggaagaaggtatctggatgatggatgcccccatg
ccggagcttggacataacgacattatgattaagatccgcaaaagcgcgatctgcggaacg
gatgtgcatatctataactgggacgagtggtcgcagaagaccattcccgttcccatggtc
gttgggcatgaatacgtgggtgaagtcgttgctatcggccaggaagttaatggctttcat
attggcgacagagtctcgggtgaaggacatattacctgcggctactgccgcaattgtcgt
gcagggcggcgtcatttatgccgcaacgccatcggtgttggagtaaaccgtcccggttcg
ttcgcggaatatctggtgatccctgcctataacgcatttcgtatccccgacaatattccc
gacgagctggccgccattttcgatcctttcggtaacgccgtgcataccgcactttccttc
gatttagtcggggaagatgtgttgattgccggagcggggccgataggcatgatggcggtg
gcggtgtgccgtcacgctggcgcgaggaatgtcgtgattaccgatgtgaatgcgtaccgt
ctggagctagccagtaaaatgggggcaacgcgtgtcgtcaatgtggcagaggaaaagctg
tctgacgtgatgatagaactgggcatgaccgaggggtttgatattgggttggagatgtcg
ggcgcgccatcggcctttcgcgccatgctgaaagcgatgaatcacggtggacgcattgct
atgttgggcattccgcatgagccgatgtcgattgactggggtgaagtgatttttaagggg
ctgtttatcaaagggatctacggacgggaaatgttcgaaacctggtacaaaatgtcggca
ctgattcagtctgggctggatttgtccccgattatcactcaccgctttcatattgatgaa
tttcagaaagggttcgatgccatgcgctcgggtcaatcgggcaaggttattctcagttgg
gatgagacataa

DBGET integrated database retrieval system