KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_19700Help
Entry
A8F97_19700       CDS       T04513                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Pathway
ppar00620  Pyruvate metabolism
ppar00680  Methane metabolism
ppar01100  Metabolic pathways
ppar01120  Microbial metabolism in diverse environments
ppar01200  Carbon metabolism
Module
ppar_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ppar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A8F97_19700
  09102 Energy metabolism
   00680 Methane metabolism
    A8F97_19700
Enzymes [BR:ppar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A8F97_19700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOR61096
UniProt: A0A0H3IEN0
LinkDB All DBs
Position
complement(4351606..4354245)
Genome map
AA seq 879 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKEALGENILDKVETIRKLSKSSRAGNEKHRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHTISPHGEAASNPAQLSNAFERLKENKDLTER
DIRDAVESLSIELVLTAHPTEITRRTLIHKLVEVNTCLKQLDHNDLADYERNQIMRRLRQ
LIAQSWHTDEIRKIRPTPVDEAKWGFAVVENSLWEGVPAFLRELDEQLEQAFGYRLPVDA
VPVRFTSWMGGDRDGNPNVTAEVTRHVLLLSRWKAADLFLRDIQVLVSELSMSECTPELL
ELAGGNEVQEPYRAIMKSLRSQLSSTLSYLEARLTGEERLPPKDLLITNEQLWEPLYACY
QSLKTCGMGIIADGRLLDTLRRVRCFGVPLVRIDVRQESTRHTDALAEITRYLGLGDYES
WSESDKQAFLIRELSSKRPLLPRYWEPSADTKEVLDTCRVIAKAPQGSIAAYVISMARTP
SDVLAVQLLLKEAGCPFALPVAPLFETLDDLNNADDVMTQLLSIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYRAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLALYTGAILEANLLPPPEPKQEWHQVMDEL
SRVSCDMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVDDGKQGQLEEMCRNWPFFSTRIGMLEMVFAKADLWLAE
YYDQRLVEEKLWPLGKQLRDQLAADISIVLAISNDDHLMADLPWIAESIALRNVYTDPLN
VLQAELLHRSRQQEQPDADLELALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgcagtaacgtcagtatgctcggcaaactactcggc
gatactatcaaggaagcactgggtgaaaacatccttgataaagtcgaaacaatccgcaag
ttgtcaaagtcatcccgtgcaggtaatgaaaaacatcgtcaggaactgctgactacactg
caaaacctgtctaacgatgagctgttgcccgttgcccgcgcattcagccagttccttaac
ctgaccaataccgctgagcaatatcatacgatttcaccacacggcgaagcagcgagtaac
ccggcacagctttccaatgcctttgagcgtctaaaagaaaataaagatctgaccgaacgc
gatatccgcgacgcggtagaatcgttgtcgatcgagctggtcctgaccgcacacccgacc
gagatcacccgccggacgctgatccacaaactggtagaagtgaacacctgcctcaagcag
ctcgaccacaacgatttggctgattatgagcgcaatcagatcatgcgtcgtctgcgccag
ttaatcgcacagtcctggcataccgatgaaatccgcaaaattcgcccgactccggtagat
gaagccaaatggggtttcgccgtagtggaaaacagtctgtgggaaggcgtacccgccttt
ttacgtgagctggatgagcagttggaacaggctttcggctaccgtctgccggttgacgcc
gtaccggtacgctttacctcgtggatgggtggcgaccgcgacggtaacccgaatgtcacg
gcagaagtcactcgtcatgtgctgttgctcagccgctggaaagccgccgacctgttcctg
cgtgatattcaggtactggtttctgagctatcgatgtccgaatgtacaccggagctgttg
gagttggccggtggcaacgaggtacaagaaccgtaccgcgcgatcatgaagtcactgcgt
tcgcagttgagcagcacgctgagctatctggaagcacgtctgacgggtgaagaacgcctg
ccccctaaagatttgctgattaccaacgagcaactgtgggaacccctgtacgcctgctat
cagtctctgaaaacctgcggtatgggcatcatcgccgacggtcgtctgctggatacgctg
cgtcgcgtgcgctgcttcggtgtaccgctggtacgcattgatgtccgtcaggaaagcacc
cgccacaccgacgcgctggccgaaattacccgttatctgggtctgggcgattatgaaagc
tggtcagaatccgataagcaagccttcctgatccgcgaactcagctccaagcgcccgctg
ctgccgcgctactgggaaccgagtgcagataccaaagaagtgctggatacctgccgggtg
atcgcgaaagcgccacagggttctattgccgcttacgttatttcaatggcgcgcacgcct
tccgacgtgctggccgttcaactgctgctcaaagaagctggttgcccgtttgctctgcct
gtcgcaccgctgtttgaaacgctggatgacctgaacaacgctgacgatgtcatgacgcag
ttgctgagcattgactggtatcgcggctttattcagggcaagcagatggtcatgatcggt
tattccgactctgcgaaagacgcaggcgtgatggctgcctcctgggcgcagtatcgtgcg
caagatgcgctgatcaaaacctgtgagaaagccggcatcgcactaacgctgttccacgga
cgcgggggttccatcggtcgcggtggcgcaccggctcacgccgcgctgttgtcacaaccg
ccgggcagcctgaaaggtggcctgcgcgtaacagaacagggcgagatgatccgctttaaa
tacggcctgccggaagtcaccatcagcagcctggcgctgtataccggtgcgatcctggag
gcgaacctgctgccaccgccggagccaaaacaagaatggcatcaggtaatggacgaactg
tcacgcgtgtcctgcgatatgtaccgtggctacgtgcgcgaaaaccctgatttcgttccg
tacttccgcgccgctacgccggagctggagctgggtaaactgccgctgggctcgcgtccg
gccaaacgtcgtccgaacggcggcgtagaaagcctgcgcgcgatcccgtggattttcgcc
tggacgcagaaccgcctgatgctgccagcctggctgggtgcaggtgccgcattacagaaa
gtggtagatgacggcaagcagggacagttagaagaaatgtgtcgcaactggccgttcttc
tcaacgcgtatcggcatgctggagatggtattcgccaaagccgacctatggctggcggag
tattacgatcagcgtctggtagaagagaagctatggccgttagggaagcaactgcgcgat
cagttggccgccgatatcagcattgtgctggcgatctccaacgacgatcacctgatggca
gacctgccgtggatcgccgagtccatcgcactgcgtaacgtctacaccgacccgctgaac
gtgttgcaagcagagctactgcatcgctcacgccaacaggaacaaccggatgccgatctg
gagctggcgctgatggtcaccatcgccggtgtcgcagcaggcatgcgtaatacgggctaa

DBGET integrated database retrieval system