KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_21145Help
Entry
A8F97_21145       CDS       T04513                                 

Definition
(GenBank) carboxypeptidase/penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Pathway
ppar00550  Peptidoglycan biosynthesis
ppar01100  Metabolic pathways
ppar01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ppar00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A8F97_21145
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    A8F97_21145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ppar01003]
    A8F97_21145
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppar01011]
    A8F97_21145
Enzymes [BR:ppar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     A8F97_21145
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A8F97_21145
Glycosyltransferases [BR:ppar01003]
 Polysaccharide
  Bacterial polysaccharide
   A8F97_21145
Peptidoglycan biosynthesis and degradation proteins [BR:ppar01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   A8F97_21145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase DUF3502
Motif
Other DBs
NCBI-ProteinID: AOR61365
UniProt: A0A0H3IE03
LinkDB All DBs
Position
complement(4664499..4667054)
Genome map
AA seq 851 aa AA seqDB search
MKFVKYLFILAVSCILLGAASIYGLYRYIEPQLPDVATLKDVRLQTPMQVYSADGELIAQ
FGEKRRIPLKLDQIPPELVHAFIATEDSRFYDHHGVDPVGIIRAASIALTSGHASQGAST
ITQQLARNFFLSPERTLIRKIKEVFLAIRIEQLLTKDEILELYLNKIYLGYRAYGVGAAA
QVYFGRPVDQLTLSEMAMIAGLPKAPSTFNPLYSYDRAVARRNVVLARMKDENYITPSQY
DAARNEKLVANYHAPEISFSAPYVAEMARQEMFKRYGEDAYNDGYKVYTTVTKKLQTAAQ
DALRNNILAYDMRHGYRGPGKVLWKVGEGVWDQAKMIAALKALPVYGPLSPAIVTSTTAD
NAIAILSDGSNIALPMAGMRWARAYRSDTQQGPTPKRVTDVVQTGQQIWVRKVNDDWWLA
QVPDVNSAIVSLNPKNGAIEALVGGFDFNQSKFNRATQALRQIGSNIKPFLYTAAMDKGL
TLATILNDVPITRWDAGAGSDWRPKNSPATYDGPIRLRQGLGQSKNVVMVRAMRAMGVDY
AAEYLQRFGFPAQNIVHTESLALGAASFTPLQVVRGYAVMANGGYLVDPYLISKIENEVS
GTVFTATPKVVCDTCNLPLVYGDTPRSPVLATTNVEDVATSNEAPPLGLPQPELEPVTPE
AAQQNAAQPYAPHVISTPLSFLIKDALNSNVFGEPGWMGTGWRAGRDLKRRDIGGKTGTT
NSSKDAWFSGYGPNLVTSVWIGFDDHRRDLGASSASGAIKDQISGYEGGAKSAQPAWDDF
MKAALDGVPEQPLTPPPGVVSVVIDRSSGKLSSGGGNSRSEYFVEGTQPKEYEVHEVGTT
LMDNGQSEELF
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtatctattcatccttgcagtctcttgcattctgctgggagctgcc
tcgatatatggtttgtaccgctatatcgaaccccaactgcccgatgtcgccacgctgaaa
gacgtccggctacaaacgccaatgcaggtctacagcgccgacggcgaactgatcgctcaa
tttggtgagaaacgccgtatcccgctcaagctggaccagattcctcctgagttggtacat
gcttttatcgcgaccgaagacagccgcttctatgatcaccatggtgtcgatcccgtcggg
attatccgcgccgcatctatcgcgctcacctctggtcatgcctctcagggggcgagtacc
attacgcaacagctcgccaggaacttcttcctgagcccagaacgcactctgattcgtaag
atcaaggaagtgtttctggctatccgtattgagcagttgctgaccaaagatgagatcctt
gagctctatctgaacaagatttacctcggctatcgcgcctatggcgttggcgcagcggca
caggtttactttggtcgccctgttgaccagttaacgctgagcgaaatggcgatgatcgcc
ggcttgccgaaggctccatctacgttcaacccgctctattcctacgaccgcgccgttgcc
cgccgcaacgtagtgcttgcgcgaatgaaggatgaaaactacatcacgccgtcgcaatac
gatgcggcgcgtaacgaaaagctggtcgcgaattatcacgcgcctgaaatttcgttctcc
gcaccgtatgttgcagaaatggcgcggcaggagatgttcaaacgctacggcgaagatgca
tacaacgacggttataaggtctacacgacggtcaccaaaaaattgcaaactgccgcacag
gatgcattgcgtaataacattctcgcctatgacatgcgccacggttatcgcggcccaggc
aaagtgttatggaaagtgggtgaaggcgtttgggatcaggcgaagatgattgccgccctg
aaagcgttgccggtctacggccccctctctccagccatcgtcaccagcacaacagcagac
aacgccattgctatcctgtctgacggcagcaacattgccttgccgatggcgggtatgcgc
tgggcacgcgcctatcgttctgatacgcagcaagggccaacaccgaagcgtgtaacggat
gtagtgcagacaggccaacagatttgggtgcgtaaagtgaacgatgactggtggctggca
caggtgccggacgtcaactctgctatcgtctcactcaacccgaaaaatggcgcaatagaa
gcgctggttggcggctttgactttaaccaaagcaaattcaaccgtgcaacacaggcgcta
cgtcagattggttccaacatcaaaccgtttctgtacaccgcggcgatggacaaaggttta
acgctggcaacaattctgaacgatgtacccatcacccgttgggatgccggtgcaggatct
gactggcggccgaaaaactccccggcaacctatgacggcccgatccgtttgcgccagggg
ttaggccaatctaaaaacgtggtgatggtgcgcgccatgcgcgcgatgggcgtcgactat
gcggcggaatacctgcaacgcttcggtttcccggcgcagaatatcgtccataccgaatcg
ctagcgctgggtgcggcctcgtttacgccgctacaggttgtacgtggttatgccgtcatg
gcaaacggcggctatctggtcgatccctatctgattagcaagatagagaacgaagtaagt
ggaacggtctttaccgcgacaccgaaagtagtttgtgatacctgtaatctaccgttggtc
tacggtgatacgccacgttctccggtgctagcaaccactaacgttgaagatgtggccaca
tcaaacgaagcaccgccgttaggtctgccgcaaccagaactggagcctgttacaccagag
gccgcacagcaaaatgcagcacagccttatgcaccgcacgttatcagtaccccactgtca
ttcctgattaaagacgcgctgaacagcaacgtctttggtgaaccaggttggatgggaacg
ggctggcgcgcaggtcgtgatttaaaacgtcgtgatatcggcggtaaaaccggtacaaca
aacagttccaaagatgcctggttctccggttatggcccgaatctggtgacttcagtctgg
atcggcttcgacgatcatcgccgcgatctgggtgccagtagcgcatctggggccatcaaa
gatcagatctccggctatgaaggtggcgcaaaatcggcccagcccgcatgggatgatttt
atgaaggccgcactggatggcgtaccggaacaaccgctgaccccgccacccggcgtcgtc
agcgtggtcattgaccgcagcagcggcaagttgtccagcggtggagggaacagccgttcc
gaatacttcgtcgagggtacgcagccgaaagaatacgaagtgcatgaagtcggcaccacg
ctgatggataacggacaaagcgaagaactgttctag

DBGET integrated database retrieval system