KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_21175Help
Entry
A8F97_21175       CDS       T04513                                 

Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Pathway
ppar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppar01100  Metabolic pathways
ppar01110  Biosynthesis of secondary metabolites
ppar01130  Biosynthesis of antibiotics
ppar01230  Biosynthesis of amino acids
Module
ppar_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ppar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A8F97_21175
Enzymes [BR:ppar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     A8F97_21175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin dNK Cytidylate_kin2 AAA AAA_16 AAA_22 TsaE APS_kinase ABC_tran AAA_5 AAA_25 AAA_7 AAA_17 Ploopntkinase3 AAA_24 RNA_helicase AAA_28 AAA_PrkA His_biosynth AAA_29 RsgA_GTPase AAA_14 Mg_chelatase IstB_IS21
Motif
Other DBs
NCBI-ProteinID: AOR61371
UniProt: A0A0H3IB58
LinkDB All DBs
Position
4671230..4671751
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVETPPREVLEALAKERNPLYEEIADVTIRTDEQSAKVVANQIINMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
ggccgtcaattagctcagcaactcaatatggagtttttcgactccgatcaagaaattgag
cgacgcactggggctgatgtgggctgggtattcgatgtggaaggcgaagaaggcttccgc
gatcgtgaagagaaagtcattaatgaattgacggaaaagcaaggcatcgtactggcaaca
ggcggtggctcagtcaaatcacgtgagacgcgtaaccgtctttctgcgcgcggcgttgtc
gtttatttggaaacgacaatcgagaagcaactggcccgcacgcagcgtgataagaaacgt
ccgttacttcaggttgaaacccctccacgtgaagtattggaagcattggcgaaagagcgg
aacccgctttatgaagaaatcgcggatgttaccattcggactgacgagcaaagtgccaag
gtcgttgctaaccagattatcaatatgctggaaagcaactaa

DBGET integrated database retrieval system