KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_21880Help
Entry
A8F97_21880       CDS       T04513                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Brite
KEGG Orthology (KO) [BR:ppar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A8F97_21880
Enzymes [BR:ppar01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A8F97_21880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin FAD_binding_3 NAD_binding_8 Thi4 DAO K_oxygenase Lycopene_cycl AlaDh_PNT_C Thioredoxin_4 DSBA FMO-like
Motif
Other DBs
NCBI-ProteinID: AOR61505
UniProt: A0A0H3I834
LinkDB All DBs
Position
4806514..4808076
Genome map
AA seq 520 aa AA seqDB search
MLDNTMKVQLKAYLEKLTKPVELMATLDDSAKSAEVRTLLTDIAELSDQVNFIEKNDLSV
RKPSFLITNPGSQSGPRFAGAPMGHEFTSLILALLQVGGHPSKEAKELLDQIRNLNGSFH
FETYYSLSCHNCPDVVQALNLMAVLNPKITHTAIDGGVFQDEIQNRNVMGVPTIFLNGEH
FSQGRTSLAEIVAKIDTGAGAKQVEKLNQRDVYDVLIIGSGPAGAAAAVYSARKGIRTGL
VGERFGGQVLDTVDIENYISVPKTEGAKLATALKSHVDDYDVDVIDAQSAEALIPGGEPG
KPHQVITVSGATLKARSVIIATGARWRNMNVPGEDQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQEKVRSLPNVDIILNAQTTEVKGD
GQKVTGLSYKDRVTDTVQDLPLEGIFVQIGLLPNTHWLEGTVARNRIGEIEIDAKCETSV
KGIFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTRA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaatacgatgaaagtccagttgaaagcctatctggaaaaattaaccaaacct
gttgagttaatggcgactctagatgattccgctaaatctgcggaagtcagaaccttgctg
accgatattgccgagttgtccgatcaggtcaactttattgaaaagaatgatctatccgtc
cgtaagccttcgtttctgattactaaccccggttcccaaagcggtccacgttttgccggt
gcgccgatggggcatgaatttacctccctgattctggcgttattgcaggtgggtggacat
ccgtcgaaagaagcaaaagaattactcgatcaaatccgcaatcttaacggttcgttccac
tttgaaacgtattactcgctgtcctgccacaactgcccggacgtggtgcaggcgctgaat
ttaatggcggtgttgaatccgaagatcacccataccgcgatagacggcggcgtgtttcag
gatgagatccaaaaccgtaatgtcatgggtgttcccaccattttcctgaacggcgaacat
ttcagccaggggcggacgagtcttgcggagattgtggctaaaatcgataccggtgcaggc
gctaaacaggttgagaagctgaaccagcgtgacgtctatgatgtgttaatcatcggcagc
ggcccggcaggggcggcagcggcagtctattcggcgcgtaaaggcatccgcaccggtttg
gtcggtgaacgctttggcggtcaggtgctggataccgttgatatcgaaaactacatttct
gtgccgaaaacggaaggtgccaaactggcgaccgcactgaagagccatgttgatgactat
gatgttgatgtgatcgacgcgcagagtgcagaagctttaattcctggcggagagccgggt
aaaccgcatcaggtgattaccgtatccggtgcgacgctgaaagcgcggagtgtgatcatt
gcgacaggcgcgcgttggagaaacatgaatgtgccgggtgaagatcagtaccggacgcgc
ggggtaacgtactgcccacactgtgatggtccgctgtttaaaggtaagcacgttgcggtg
attggcggtggaaactccggcgtagaagcggctatcgatctggctggtgtggtgaaacac
gtcacgctgcttgagtttgcaccggagctgaaagcggattcggtattgcaggagaaggta
cgcagcctgccgaacgtcgatatcattctgaatgcgcaaaccacagaagtgaagggcgat
gggcagaaggtgacgggactgagctacaaagatcgtgttaccgatacggtgcaggattta
cccctggaagggatcttcgtgcagattggtttgttgcctaacacccactggttagaaggc
acggttgccagaaaccgcattggtgaaatagagatcgatgccaagtgtgaaactagcgtg
aaagggatctttgctgctggcgactgtacgacggtgccgtacaaacagatcattatcgcg
acgggtgaaggagcaaaagcgtccttgagtgcttttgattacctgatcagaacacgggcg
taa

DBGET integrated database retrieval system