KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_22575Help
Entry
A8F97_22575       CDS       T04513                                 

Definition
(GenBank) peptidoglycan glycosyltransferase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Pathway
ppar00550  Peptidoglycan biosynthesis
ppar01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ppar00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A8F97_22575
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    A8F97_22575
Enzymes [BR:ppar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A8F97_22575
Peptidoglycan biosynthesis and degradation proteins [BR:ppar01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   A8F97_22575
Chromosome and associated proteins [BR:ppar03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    A8F97_22575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AOR61642
UniProt: A0A0H3ID34
LinkDB All DBs
Position
4964697..4966460
Genome map
AA seq 587 aa AA seqDB search
MKAARTGKLKRQEDQASFVSWRFALLCGCILLAMVGLMARAAYLQVINPDKLVREGDMRS
LRVQEVPTARGMISDRAGRPLAVSVPVNAVWADPKEVNDRGGITLDTRWKALSDALDIPL
DQLATKINANPKGRFVYLARQVNPAIGEYVHKLKLPGINLRQESRRYYPSGQVTSHLIGF
TNIDGQGIEGVEKSFDRWLTGQPGERTVRKDRFGRVIEDISSVDSQAAHNLALSIDERLQ
ALVYRELNNAVAFNKAESGTAVLVDVNTGEVLAMANSPSYNPNNLAGTPKDIMRNRAITD
IFEPGSTVKPMVVMTALQRGVVKENSVLNTLPYYVNGHEIKDVARYSELTLTGVLQKSSN
VGVSRLALAMPSSALVDTYARFGLGKATNLGLVGESSGLYPQKQRWSDVERATFSFGYGL
MVTPLQLARVYATIGSFGIYRPLSITRVDPPVPGERVFPEALVRSVVHMMESVALPGGGG
TKAAIKGYRIAIKTGTAKKVGPDGKYINKYIAYTAGVAPASNPRFALVVVINDPQAGKYY
GGAVSAPIFGAIMGGVLRTMNIEPDALPVGDKNEFVINREEGSGGRS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcccgtacaggaaagttaaagcgccaggaagatcaagccagctttgttagc
tggcgttttgcgttgctttgcggctgtatcctgcttgcgatggttggcttgatggctcgt
gcggcttatcttcaggtgatcaatccagacaaactggtgcgcgaaggcgatatgcgctcc
ctgcgcgttcaggaagtgccaacggcgcgcggtatgatcagcgatcgcgctggtcgccct
ctggccgtcagtgtacccgtgaatgccgtgtgggccgatccgaaagaagtgaacgatcgt
ggtggcatcacgctcgatacgcgctggaaagcactgtctgatgcgctcgatatcccgtta
gatcagttggcaaccaagatcaatgctaacccgaaagggcgcttcgtttatctggcgcgt
caggttaacccggctattggtgaatacgttcataagctgaaattaccaggaattaatctg
cggcaggagtctcgtcggtactatccttcagggcaagttacctctcaccttattggtttc
accaatatcgatggacagggcatcgaaggggtagagaaaagttttgaccgctggctgact
gggcaacccggtgagcggaccgtgcgtaaagaccgatttggccgcgtgattgaagatatc
tcctccgttgacagccaggctgcacataatctggcgctcagtattgatgagcgtttgcaa
gcgctggtttaccgtgaacttaataacgccgttgcctttaacaaagccgaatcgggaacg
gctgtgctggtcgatgtgaatactggcgaagtgttagcaatggcgaatagcccgtcttat
aacccgaacaatctggcgggtacgccgaaagacatcatgcgtaaccgcgctatcaccgac
attttcgaacctggctctaccgttaaaccgatggtggtgatgacggccttgcagcgcgga
gtagtgaaagagaatagcgtgctcaacacgctgccgtattacgtcaatggtcatgagatc
aaagatgtggcgcgttacagtgagttaacgctgacgggcgtgctccaaaaatcgagtaac
gtcggtgtatccagactggcgttagcgatgccttcctctgcgctggtcgatacttacgcg
cgctttggattaggaaaagcgaccaatttggggttggtcggagaaagcagtggcttatat
cctcaaaaacaacggtggtctgacgtagagcgggccaccttttctttcggctacgggctg
atggtaaccccattacagttagcgcgagtctatgccacgatcggcagtttcggtatttac
cgcccgctgtcgattaccagagtcgatccccccgtgcctggcgagcgtgtcttccctgaa
gcgctggtgcgttccgtggtgcacatgatggaaagcgttgcactacccggcggtggcggc
accaaggcagccatcaagggctaccgtatcgcgattaaaaccggtacagccaagaaagtc
ggcccagatggtaaatacatcaacaaatatattgcctatacggcgggcgtggcaccagcc
agtaacccacgttttgctctggttgtcgtgatcaacgatccgcaggcagggaagtactac
ggcggcgcggtttctgcgccaatctttggcgccatcatgggcggcgttctgcgtacgatg
aatatcgaaccggatgcgttgccagtgggcgacaaaaacgagtttgtaattaatagagaa
gagggatcaggtggcagatcgtaa

DBGET integrated database retrieval system