KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1661Help
Entry
PPUBIRD1_1661     CDS       T01975                                 

Gene name
sdhA
Definition
(GenBank) SdhA
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00020  Citrate cycle (TCA cycle)
ppb00190  Oxidative phosphorylation
ppb00650  Butanoate metabolism
ppb01100  Metabolic pathways
ppb01110  Biosynthesis of secondary metabolites
ppb01120  Microbial metabolism in diverse environments
ppb01130  Biosynthesis of antibiotics
ppb01200  Carbon metabolism
Module
ppb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPUBIRD1_1661 (sdhA)
   00650 Butanoate metabolism
    PPUBIRD1_1661 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PPUBIRD1_1661 (sdhA)
Enzymes [BR:ppb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PPUBIRD1_1661 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     PPUBIRD1_1661 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA HI0933_like FAD_binding_3 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ADR59329
LinkDB All DBs
Position
1881305..1883077
Genome map
AA seq 590 aa AA seqDB search
MASIPTISFDAIIIGGGGAGMRAALQLAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCQEGPAAVFELDHMGLPFSRTETGRIYQRP
FGGQSKDFGKGGQAARTCAASDRTGHALLHTLYQGNLKAGTTFLNEYYAVDLVKNQDGAF
VGVIAICIETGETLYIKSKATVLATGGAGRIYASTTNALINTGDGIGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINAHGERFMERYAPNAKDLAGRDVVARSMVKEI
IAGNGVGPNKDHVLLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPVPVVPTCHYMMG
GVATNIHGQAITMDADGQDHIIPGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALSEGVEYRDASDTDVDVALNRLNKLNERTSGEDVASLKRELQSCMQNYFGVFRTGE
YMQKGIEQLAGLRDRIANVKINDKSQAFNTARIEALELQNLLEVAEATAIAAEARKESRG
AHAREDFEDRDDENWLCHTLYYPGEKRVAKRGVNFAPKTVPAFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctagcattccaaccatttccttcgacgccatcatcatcggtggcggcggcgccggc
atgcgcgcagcgctgcaactggctcaaggcggccacaagactgccgtagtcaccaaggtc
ttcccgacccgttcgcacaccgtatccgcccagggcggcattacctgcgccatcgcttcg
gccgacccgaacgacgactggcgctggcacatgtacgataccgtcaagggttccgactac
atcggtgaccaggacgctatcgaatacatgtgtcaggaaggcccggctgcggtcttcgaa
ctggaccacatgggtctgccgttctcgcgcaccgaaaccggtcgcatctaccagcgcccg
ttcggtggtcagtccaaggacttcggtaaaggtggccaggccgcccgtacctgtgccgct
tccgaccgtaccggtcacgcgctgctgcacaccctgtaccagggcaacctgaaagcgggt
accacattcctcaacgagtactatgcagttgacctggtgaaaaaccaggacggcgcattc
gtgggtgtgatcgccatctgcatcgaaactggcgaaaccctgtacatcaagtccaaggca
accgtgctggccactggcggtgcgggccgtatctatgcgtccaccaccaacgccctgatc
aacaccggtgacggtatcggcatggccctgcgtgcaggcgtgccggtgcaggacatcgaa
atgtggcagttccacccgaccggtatcgccggcgccggtgtactggtcaccgagggttgc
cgcggtgaaggtggctacctgatcaacgcccacggcgagcgcttcatggagcgttacgcg
ccgaacgccaaagacctggccggccgcgacgtggttgcccgttccatggtcaaggaaatc
atcgccggcaacggcgtgggcccgaacaaggaccacgtactgctgaagctggaccacctg
ggcgaggaagtgctgcacagccgcctgccaggtatctgcgagctgtccaagaccttcgcc
cacgttgaccctgtggtcgcaccggtgccggtcgtgccgacctgccactacatgatgggc
ggcgttgccaccaacattcatggccaggccatcaccatggacgccgacggccaggatcac
atcatcccgggcctgttcgccgtaggtgaagtggcgtgcgtatcggttcacggtgccaac
cgcctgggcggcaactcgctgctcgacctggtggtgttcggccgtgctgccggcctgcac
ctggagaaggcgctgagcgaaggcgtggaataccgcgacgccagcgacaccgacgtcgat
gttgccctgaaccgcctgaacaagctcaacgagcgtaccagcggtgaagacgttgccagc
ctgaagcgtgagctgcagagctgcatgcagaactacttcggtgtattccgtactggcgaa
tacatgcagaagggtatcgagcaattggccggtctgcgtgaccgtatcgccaacgtcaag
atcaacgacaagtcccaggccttcaacaccgcgcgtatcgaagcgctggagctgcagaac
ctgctggaagttgccgaagctaccgccatcgcggcggaagcccgtaaagagtcccgcggc
gctcacgcccgtgaagacttcgaagaccgtgacgacgaaaactggctgtgccacaccctg
tactacccgggtgagaagcgcgttgccaagcgcggcgtcaactttgcgccgaagactgtt
ccagccttcgaaccaaaagtccggacttactaa

DBGET integrated database retrieval system