KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1662Help
Entry
PPUBIRD1_1662     CDS       T01975                                 

Gene name
sdhB
Definition
(GenBank) SdhB
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00020  Citrate cycle (TCA cycle)
ppb00190  Oxidative phosphorylation
ppb00650  Butanoate metabolism
ppb01100  Metabolic pathways
ppb01110  Biosynthesis of secondary metabolites
ppb01120  Microbial metabolism in diverse environments
ppb01130  Biosynthesis of antibiotics
ppb01200  Carbon metabolism
Module
ppb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPUBIRD1_1662 (sdhB)
   00650 Butanoate metabolism
    PPUBIRD1_1662 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PPUBIRD1_1662 (sdhB)
Enzymes [BR:ppb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PPUBIRD1_1662 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     PPUBIRD1_1662 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: ADR59330
LinkDB All DBs
Position
1883089..1883793
Genome map
AA seq 234 aa AA seqDB search
MLKVEVYRYNPDTDSAPKMESFDVDTGGKDLMVLDVLALIKEKDEGFSYRRSCREGVCGS
DGMNMNGKNGLACITPLSAVVKGGKLVLRPLPGLPVIRDLVVDMSIFYKQYEKVKPFLQN
DTPAPAIERLQSPEDRDKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYRFLAD
SRDTKTQERLASLDDPFSVFRCRGIMNCVNVCPKGLNPTKAIGHVRNMLLQSGT
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcgaagtttatcgttacaacccggacaccgactcggcgccaaaaatggag
tcgttcgacgtcgataccggcggcaaggacctgatggtgctggatgtattggcactgatc
aaggaaaaggacgagggtttctcgtaccgtcgctcctgccgtgaaggcgtttgcggttcc
gatggcatgaacatgaacggcaagaacggcctggcctgcatcaccccgctgtcggcggtg
gtgaagggcggcaagctggttctgcgtcctctgccaggcctgccggtcattcgtgacctg
gtggtcgatatgagcatcttctacaagcagtacgagaaggtgaagccgttcctgcagaac
gacactccggccccggccatcgagcgcctgcagtcgccggaagaccgtgacaagctggac
ggcctgtacgagtgcatcctgtgcgcttgctgctcgacttcctgcccgtcgttctggtgg
aacccggacaagttcctgggcccggcagccttgctgcaagcctaccgcttccttgccgac
agccgcgataccaagactcaggagcgcctggcgtccctggatgacccgttcagcgtattc
cgctgccgcgggatcatgaactgcgtaaacgtttgcccgaaaggtctgaacccgaccaag
gcaatcggtcacgtacgtaacatgctgctgcaaagcggcacctga

DBGET integrated database retrieval system