KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1765Help
Entry
PPUBIRD1_1765     CDS       T01975                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00500  Starch and sucrose metabolism
ppb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPUBIRD1_1765
Enzymes [BR:ppb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PPUBIRD1_1765
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PPUBIRD1_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ADR59429
LinkDB All DBs
Position
2001562..2004891
Genome map
AA seq 1109 aa AA seqDB search
MAKRSRPAAFIDDPLWYKDAVIYQLHIKSFFDSNNDGIGDFAGLISKLDYIAELGVNTLW
LLPFYPSPRRDDGYDIAEYKAVHPDYGSMADARRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARHAKRGSKAREFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVLKAVIGVMRFWLDLGVDGLRLDAIPYLIERDGTNNENLVETHDVLKAIRA
EIDANYPDRMLLAEANQWPEDTRPYFGEGDGDECHMAFHFPLMPRMYMALAMEDRFPITD
ILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAEDRRARINLGIRRRLAPL
LQRDRRRIELLTSLLLSMPGTPTLYYGDELGMGDNIYLGDRDGVRTPMQWSPDRNGGFSR
ADPQRLVLPPIMDPLYGYQTVNVEAQSHDPHSLLNWTRRMLAVRKQQKAFGRGSLRTLTP
SNRRILAYIREYTDADGNTEVILCVANVSRAAQAAELELSQYADKVPVEMLGGSAFPPIG
QLPFLLTLPPYAFYWFLLASRDRMPSWHIQPTEGLPELTTLVLRKRMEELLQAPASDTLQ
STILPQYLPKRRWFAGKEGPIDAVRLCYGVRFGTATTPVLLSEIEVLSDGTATRYQLPFG
LLREEQIHTALPQQLALSRVRRAHQVGLITDAFVLEAFIHAVMQACQDGLRLPCGDGEDG
EGELRFECTEQLAGLALDEESEVRYLSAEQSNSSVVIGDRVVLKLIRRVNPGIHPELEMS
AYLTAAGFANISPLLAWVSRVDEQHAPHLLMIAQGYLSNQGDAWGWTQNTLERAIRDQME
PTRNDAEAHTDALAELSGFAALLGQRLGEMHLLLAAPTEDPAFQPRPSDAQDSERWCVQI
STELTHALDLLAQHRDTLDRDSQALVDDLQQQRDGLAQHIDTLSKQAQGGLLMRVHGDLH
LGQVLVVQGDAYLIDFEGEPARPLEERRAKHSPYKDVSGVLRSFDYAAAMILRSASAVDL
SEPARQARQRVARQYLHQSRHAFVEAYGLATAAMPHAWQHAEGERAALELFCLEKAAYEI
TYEAENRPSWLAVPLHGLHGLISTWGESE
NT seq 3330 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgttcccgcccggcagccttcatcgacgacccgctgtggtacaaggacgcc
gtcatctaccagctgcacatcaagtcgttcttcgactcgaacaatgacggcatcggcgac
ttcgccgggctgatcagcaagctcgactatatcgccgagctgggcgtcaacaccctgtgg
ctgctgccgttctatccctcgccacgccgtgacgacggctacgacatcgccgaatacaag
gccgtgcaccccgactacggcagcatggccgacgcccgccgtttcatcgccgaggcccac
aagcgcggcctgcgggtgatcaccgagctggtcatcaaccacaccagcgaccagcacccg
tggttccagcgcgcccgccacgccaagcgcggcagcaaggcgcgcgagttctacgtgtgg
tcggacgacgaccagaagtacgacggcacgcgcatcatcttcctcgacaccgaaaagtcc
aactggacctgggacccggtcgccggccagtacttctggcaccggttctactcccaccag
ccggacctcaacttcgacaacccgcaggtgctcaaggcggtgatcggcgtcatgcgcttc
tggctggacctgggtgtagatggcctgcggctggacgcgatcccttacctgatcgagcgc
gacggcaccaacaacgaaaaccttgtcgaaacccacgacgtgctcaaggcgatccgcgcc
gagatcgacgccaactaccccgatcgcatgctgctggccgaagccaaccagtggccggaa
gacactcgcccgtacttcggcgagggcgacggcgacgaatgccatatggccttccacttt
ccgttgatgccgcgcatgtacatggccttggccatggaagaccgcttccctatcaccgac
atcctgcgccagaccccggaaatcccggccaactgccagtgggcgatctttttgcgcaac
catgatgaactgaccttggaaatggtcaccgaccgcgagcgcgattacctgtggaactat
tacgccgaagaccgccgcgcgcgcatcaacctgggcattcgccggcgcctggcgcccctg
ctgcagcgtgaccgtcggcgcatagagctgctgaccagcctgctgttgtcgatgcccggc
acgccaaccctgtattacggcgacgaactgggtatgggcgacaatatctatctgggtgac
cgcgatggcgttcgcacacccatgcagtggtcgccagaccgcaacggcggtttttcccgc
gccgacccgcagcgcctggtgctgccgccgatcatggacccgctctacggttaccagacc
gtcaacgtcgaggcgcaaagccacgatccgcattcgctgctgaactggacccggcgcatg
ctggcggtgcgcaagcagcagaaggcctttggtcgcggcagcctgcgcaccctcacaccc
agcaaccggcgcatccttgcctatatccgcgagtacaccgacgccgacggcaataccgag
gtcatcctctgcgtggccaacgtgtcccgcgccgcccaggctgccgaactcgaattgtca
caatacgccgacaaagtaccggtggagatgctgggtggcagcgcgttcccgccaatcggc
caactgccgtttctgctgaccttgccaccttatgcgttctactggttcctgctggccagc
cgcgatcgcatgcccagctggcacatccagcccaccgaggggttacccgaattgaccaca
ttggtactgcgcaagcgcatggaagaactgctgcaagcccccgcaagcgatacgctgcaa
agcaccatcctgccgcagtacctgcccaagcgccgctggttcgccggcaaggaagggccg
atcgatgccgtgcgcctgtgttacggcgtgcgtttcggcaccgccaccacgccggtgttg
ctcagcgaaatcgaggtgctcagtgacggcacggccacccgctaccagctgccgttcggc
ctgctgcgtgaggaacagattcataccgcgctgccgcagcagctggcgttgtcgcgggtg
cgccgtgcccaccaggttggcttgattacagacgccttcgtcctcgaggcgttcattcac
gccgtgatgcaagcctgccaggatggcctgcgtctgccgtgtggcgacggtgaggacggt
gagggtgaattgcgcttcgaatgcacagagcaactggccggcctggcgctcgacgaggag
agcgaagtgcgctacctcagcgccgagcagtccaacagttcggtggtcatcggcgaccgc
gtggtgctcaagctgatccgccgggtcaacccgggtatccatccagagctggaaatgagt
gcctacctgaccgccgccggctttgccaatatctcgccgctgctggcctgggtcagccgg
gtggacgagcaacacgcgccgcacctgctgatgattgcccaaggttacctgagtaaccag
ggcgacgcctggggctggactcagaacacgctggaaagggccatccgcgaccagatggag
cccacccgcaacgacgccgaagcgcacactgacgccttggccgaactcagcggctttgcg
gccttgcttggccagcgcctgggcgagatgcacctgctgctggccgcacccaccgaagac
ccggccttccagccgcgccccagcgatgcgcaggacagcgagcgctggtgtgtacagatc
agcactgaactgacccacgccctcgacctgctggcccagcaccgtgacaccttagaccgc
gacagccaggccttggtcgacgacctgcagcaacagcgtgacggcctggcccagcacatc
gacaccctgagcaagcaggctcaggggggcctgctgatgcgtgtacacggcgacctgcat
ctgggccaggtgctggtggtgcagggggatgcctacctcatcgattttgaaggcgaaccc
gcccggccccttgaagagcgccgggcaaaacacagcccctacaaggatgtcagcggcgtg
ctgcgatccttcgactatgctgctgcgatgatcttgcgcagcgcgtctgcggtggacctt
tccgaaccggcgcggcaagcccggcagcgggttgcccggcagtacctgcaccagtcccgg
catgcctttgtcgaagcctatggcctggccactgccgccatgccccacgcctggcagcac
gccgagggcgagcgcgcggcgctggagctgttctgcctggaaaaagccgcctacgagatt
acatacgaagccgaaaaccgtccgagctggctggccgtgcctttgcatggtctgcatgga
ctgatcagtacctggggagagtcagaatga

DBGET integrated database retrieval system