KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_2040Help
Entry
PPUBIRD1_2040     CDS       T01975                                 

Gene name
alr
Definition
(GenBank) Alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00473  D-Alanine metabolism
ppb01100  Metabolic pathways
ppb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    PPUBIRD1_2040 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PPUBIRD1_2040 (alr)
Enzymes [BR:ppb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PPUBIRD1_2040 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ppb01011]
 Precursor biosynthesis
  Racemase
   PPUBIRD1_2040 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADR59688
LinkDB All DBs
Structure
PDB: 

Position
2300534..2301676
Genome map
AA seq 380 aa AA seqDB search
MDNGTNTLTVQNSNAWVEVSASALQHNIRTLQAELAGKSKLCAVLKADAYGHGIGLVMPS
IIAQGVPCVAVASNEEARVVRASGFTGQLVRVRLASLSELEDGLQYDMEELVGSAEFARQ
ADAIAARHGKTLRIHMALNSSGMSRNGVEMATWSGRGEALQITDQKHLKLVALMTHFAVE
DKDDVRKGLAAFNEQTDWLIKHAKLDRSKLTLHAANSFATLEVPEARLDMVRTGGALFGD
TVPGRTEYKRAMQFKSHVAAVHSYPAGNTVGYDRTFTLARDSRLANITVGYSDGYRRVFT
NKGHVLINGHRVPVVGKVSMNTLMVDVTDFPDVKGGNEVVLFGKQAGGEITQAEMEEING
ALLADLYTVWGSSNPKMLVD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggacaacggcaccaacaccctgaccgtgcagaacagcaacgcctgggttgaggtcagt
gccagcgctctgcaacacaatatccgcaccctgcaggccgagctggccggcaagtccaag
ctgtgcgctgtgctcaaggccgatgcctatggccacggtatcggcctggtaatgccatcg
atcatcgcccagggcgtgccctgcgtggcggtggccagcaacgaggaggcccgcgtggtc
cgcgccagtggcttcaccgggcaactggtgcgggtacgcctggccagcctcagcgagctg
gaagatggcttgcagtacgacatggaggagctggtgggcagcgcggaattcgcccgccag
gccgatgccatcgccgcgcgccatggcaagaccctgcgcattcacatggcgctcaactcc
agcggcatgagccgcaacggggtggagatggccacctggtccggccgtggcgaagcgctg
cagatcaccgaccagaagcacctcaagctggtcgcgctgatgacccactttgccgtggag
gacaaggacgatgtccgcaagggcctggcagccttcaacgagcagaccgactggttgatc
aagcacgcgaagctcgaccgcagcaagctcaccctgcacgccgccaactcgttcgctacg
ctggaggtgccggaagcgcgcctggacatggtgcgaacggggggcgcgctgttcggcgac
accgtgccggggcgcactgagtacaagcgtgcgatgcagttcaaatcgcatgtggcggcg
gtgcacagctatccggctggcaacaccgtgggctatgaccgcaccttcaccctggcccgt
gattcgcgtctggccaacattacggtcgggtactccgatggctaccgccgggtattcacc
aacaagggccatgtgctgatcaacggccaccgtgtgccggttgtgggcaaggtgtcgatg
aacacgctgatggtcgatgtcaccgacttccctgatgtgaaggggggcaacgaagtggtg
ctgtttggcaagcaggccgggggcgaaatcacccaggccgagatggaagaaatcaacggc
gcgttgctcgccgatttgtacaccgtatggggcagttccaacccgaagatgctcgtcgac
tga

DBGET integrated database retrieval system