KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_2520Help
Entry
PPUBIRD1_2520     CDS       T01975                                 

Definition
(GenBank) Ku family containing protein
  KO
K10979  DNA end-binding protein Ku
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PPUBIRD1_2520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppb03400]
    PPUBIRD1_2520
DNA repair and recombination proteins [BR:ppb03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PPUBIRD1_2520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ku Tom5
Motif
Other DBs
NCBI-ProteinID: ADR60146
LinkDB All DBs
Position
complement(2864269..2865090)
Genome map
AA seq 273 aa AA seqDB search
MARAIWKGAISFGLVHIPVALNTAVRTERVDFDWLDKRSMEPVGYKRVNKVTGKEIDKDN
IVKGVEFEKGRYVVISEEEIRKARPEATQTIDIFSFVEAGDIPLQHFDTPYYLTPDRRGG
KVYALLRETLEKTGKVALATVVLHTRQHLALLRPLDHALVMITLRWPEEVRGLETLELDA
SVTDSKVEKRELEMAKRLVEDMSGPWKPEDYHDAFRQTIMDLVEEKASKGKIEAVEKGDA
GGAEKGADILDLTELLKRSLGGKKPVKKTRKAS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggctcgggcaatctggaaaggcgccatcagttttggccttgtgcacatccccgtggca
ctcaataccgccgtgcgcaccgagcgcgtggacttcgactggctggacaagcgcagcatg
gagccggtcggctacaagcgggtgaacaaagtgaccggcaaggaaatagacaaggacaat
atcgtcaagggcgtagagttcgagaagggccgctatgtggtgatcagtgaagaggagatc
cgcaaggcccggcccgaagcgacccagacgatcgatatcttttcctttgtggaagcgggc
gatattccgctgcagcatttcgatacgccgtactacctgaccccggaccgccgtggcggc
aaggtgtacgccttgctgcgcgagacgctggaaaagaccggcaaggtggcactggccacc
gtggtattgcatacccggcagcacttggcgctgctgcggcctctggaccatgcgctggtg
atgatcaccttgcgctggcctgaagaggtgcgcgggctggaaacgctggagctggatgcc
agcgtgaccgacagcaaggtggagaagcgtgagctggagatggccaagcgcctggtagag
gacatgagcgggccctggaagcctgaggattatcatgacgccttccgccagacgatcatg
gacctggtggaggagaaggccagcaagggcaagatcgaggcggtggagaagggcgacgca
gggggggccgagaaaggtgcggacatcctcgacctgaccgaactgctcaagcgcagcctg
ggtggcaagaaaccggtgaagaaaacgcgaaaggcttcatga

DBGET integrated database retrieval system