KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_2919Help
Entry
PPUBIRD1_2919     CDS       T01975                                 

Definition
(GenBank) Beta-ketoacyl synthase
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00061  Fatty acid biosynthesis
ppb00780  Biotin metabolism
ppb01100  Metabolic pathways
ppb01212  Fatty acid metabolism
Module
ppb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PPUBIRD1_2919
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PPUBIRD1_2919
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppb01004]
    PPUBIRD1_2919
Enzymes [BR:ppb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     PPUBIRD1_2919
Lipid biosynthesis proteins [BR:ppb01004]
 Fatty acid synthase
  Component type
   PPUBIRD1_2919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADR60531
LinkDB All DBs
Position
complement(3281902..3283113)
Genome map
AA seq 403 aa AA seqDB search
MKQAVAIAGAGCVLPSGWGVESFWAAATEGRSAITALNARRFSSQRVVAFGQIQDQDHQR
SRQDLAQNLQRYCTPAVIWGVSAVRQALEEAGLADEQPDVRFGLYCCQGGYTHPSLESYA
ELLHGCRQDGVADMAAFAKRILQDRAQDPFLVLKGLSNCLLGVTSLALKLVGECNAYMQG
VAGNLAALREATAALQAGRIDAAIVVGAGSELDALALSGLVQAGVISANGSNTLLPFDLR
GTGGIAGEGAAALVLRRREDLPAGPQACLADMTAHATLGRLSLPDSPTDVLVCSGTGDAH
KDRVLCQTLALARASHITSGLAINGILSAAPSLVDLMLARCALQAQSVPPIAGLRQPVAN
LPFIQGAPQAASLAHCLVLNRDDNGFSAAYQVLYSAKATQDCR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcggtcgcgattgccggtgcgggttgcgtgttgcccagcggctggggtgtc
gagtctttctgggcggccgcaaccgaagggcgcagtgcaattacggcgctgaacgcccga
cggttcagcagccaacgcgtggtggcgttcgggcaaattcaggatcaggaccaccaacgc
agccgacaagaccttgcgcaaaaccttcagcgttactgcacgccggcagtgatctggggt
gtcagcgcggtacgtcaggctttggaagaagccggcctggccgatgagcagccggatgtc
cgtttcggtttgtattgctgtcagggcggctacacccatccgtctctggaatcctatgcc
gagttgttgcacggctgtcggcaggacggcgtcgccgacatggcggcgttcgccaaacgg
atcctgcaagaccgtgcccaggacccttttctggtgctcaaaggcttgagcaactgcttg
ctgggtgtcaccagcctggcgctgaaactggtgggtgagtgcaacgcctatatgcaaggt
gtcgccggcaacctggcagccttgcgtgaggctacggccgctttgcaggctggccggatt
gacgcggcaatcgttgtcggtgcgggcagcgagctggatgccctggcgctgtccgggttg
gtccaggcgggtgtcatcagcgccaacggctcgaacacgctgctgccgtttgaccttcgg
ggcaccggcggcattgccggggagggcgcggcagcgttggtgctgcgccggcgcgaagac
ctgccggccggtcctcaggcgtgcctcgccgacatgacggcccatgccaccctcggtcgc
ttgagcctgcccgacagcccaaccgatgtgttggtgtgcagcggcaccggcgatgcgcac
aaagaccgcgtgttgtgccagacgctggcccttgcgcgcgcctcgcacatcaccagcgga
ttggcgatcaacggcattctcagcgcggcgccgagcctggtggatctgatgcttgcgcgt
tgcgcattgcaggcccaaagcgtgccgccgattgccggtttgcggcagccagtggcgaac
ctgccgttcattcagggcgcgccccaagctgcgagccttgcgcattgcctggtgctgaac
cgcgacgacaacggattcagcgccgcctatcaagtgctctacagcgcaaaggccactcag
gactgccgctga

DBGET integrated database retrieval system