KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_3242Help
Entry
PPUBIRD1_3242     CDS       T01975                                 

Gene name
ahpF
Definition
(GenBank) AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppb  Pseudomonas putida BIRD-1
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PPUBIRD1_3242 (ahpF)
Enzymes [BR:ppb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PPUBIRD1_3242 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_oxidored DAO FAD_binding_3 NAD_binding_7 Glutaredoxin FMO-like Thi4 K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADR60841
LinkDB All DBs
Position
complement(3624235..3625797)
Genome map
AA seq 520 aa AA seqDB search
MLDATLKSQLKTYLERVTQPIEIVASLDDGAKSRELHDLLVEIAGLSNLITFSADGTDAR
RPSFSLNRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIQALEGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNVRHVAIDGALFQDEVESRKIMAVPSIYLNGEVF
GQGRMGLEEIIGKIDTNAGARQAEKINAKEAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTLAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRGEALIPAAEGGL
HEVRLAGGASLKAKTVILATGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAQVTLIEFDSQLRADAVLQRKLRSLPNVNVITSALTTEVLGNGE
KVTGLRYKDRTTDEQHEVALEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDAKGQTSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLAAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccacgcttaaatcgcaactgaaaacctacctggagcgggtcacccagccg
atcgagatcgttgcctccctcgacgacggcgcgaagtcccgcgaattgcacgacctgctg
gtggagattgccggcctgtcgaacctcattaccttcagcgcggacggtaccgatgcccgt
cgtccttcgttctcgctgaaccgcccgggtgccgatatcagcctgcgcttcgccggcatc
cccatgggccacgagttcacctcgctggtgctggcactgctgcaagtcggcggccacccg
tccaaggccagtgccgaagtgatcgagcagatccaggccctggaaggtgaattcaacttc
gaaacctacttctcgctgtcgtgccagaactgcccggacgtcgtccaggcactgaacctg
atggcggtactcaaccccaacgtgcgccatgttgccatcgacggtgcgctgttccaggac
gaagtggaatcgcgcaagatcatggcggtaccgagtatctacctcaacggtgaagtgttt
ggtcagggccgtatgggcctggaagaaatcattggcaagatcgacaccaacgctggcgcc
cgccaggccgagaagatcaacgccaaggaagcctttgacgtgctggttgtcggcggtggc
cccgctggcgccgctgctgctatctacgctgcccgcaagggcatccgcaccggtgttgcc
gccgagcgcttcggcggccaggtgctggacactctggccatcgagaacttcatctcggtg
caggaaaccgaagggccgaagctggccacggcgctggaagagcacgtcaaacagtacgac
gtcgacatcatgaacctgcagcgcggtgaagcgctgattccggccgccgagggcggtctg
cacgaagtgcgcctggcggggggcgcttcgctgaaagccaagaccgtgatcttggccact
ggcgcccgctggcgcgaaatgaacgtgccgggtgagcaagagtaccgtggccgcggcgtg
gcctactgcccgcactgtgacggcccgctgttcaagggcaaacgcgtggcggtgattggc
ggcggcaactcgggtgtggaagcggccatcgacctggccggtatcgtcgcccaggtgacg
ctgatcgagttcgacagccagttgcgtgccgatgcggtgttgcaacgcaagctgcgcagc
ctgccgaacgtcaacgtgatcaccagcgccctgaccaccgaggtgctgggcaatggcgag
aaggtgaccggcctgcgctacaaggaccgcaccacggatgaacagcacgaagtggcactg
gaaggtatcttcgtacagattggcctgctgcctaacactgactggctgaagggcaccgtc
gagctgtcgccgcgtggcgaaatcattgtcgacgccaagggccagaccagtatcccgggt
gtgtttgccgcaggtgacgtgactaccgtgccgtacaagcagatcgtcattgcggtgggt
gagggggccaaggcgtcgctcgcggcctttgaccacctgattcggacttcggcaccggcg
taa

DBGET integrated database retrieval system