KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_4013Help
Entry
PPUBIRD1_4013     CDS       T01975                                 

Gene name
fabZ
Definition
(GenBank) FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00061  Fatty acid biosynthesis
ppb00780  Biotin metabolism
ppb01100  Metabolic pathways
ppb01212  Fatty acid metabolism
Module
ppb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PPUBIRD1_4013 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PPUBIRD1_4013 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppb01004]
    PPUBIRD1_4013 (fabZ)
Enzymes [BR:ppb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PPUBIRD1_4013 (fabZ)
Lipid biosynthesis proteins [BR:ppb01004]
 Fatty acid synthase
  Component type
   PPUBIRD1_4013 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: ADR61596
LinkDB All DBs
Position
complement(4489741..4490181)
Genome map
AA seq 146 aa AA seqDB search
MMDINEIREYLPHRYPFLLVDRVTDLDFEAQSIRAYKNVSINEPFFNGHFPAHPIMPGVL
IIEAMAQAAGILGFKMLDAKPADGTLYYFVGSDKLRFRQPVLPGDQLVLEAKFLSRKSMI
WKFECRALVDGKPVCSAEITCAERSL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggacatcaacgagattcgcgaatacctgcctcaccgctacccgttcctgctggta
gaccgtgtgacggatctggacttcgaggcccagagcattcgtgcctacaagaatgtcagc
atcaatgagccgtttttcaatggccacttcccggcacacccgatcatgccgggtgtcctg
atcatcgaagccatggcccaggcggccggcatccttggtttcaagatgctcgatgccaag
ccggccgatggcaccctgtactactttgtcggttccgacaaactgcgtttccgtcagccg
gttctgccgggtgaccagcttgtgctggaagccaagttcctcagccgtaaaagcatgatc
tggaagttcgagtgccgcgcccttgtcgatggcaagccggtctgctcggcagaaatcacc
tgtgcggaacgctccctatga

DBGET integrated database retrieval system