KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_4144Help
Entry
PPUBIRD1_4144     CDS       T01975                                 

Gene name
ung
Definition
(GenBank) Uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ppb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    PPUBIRD1_4144 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppb03400]
    PPUBIRD1_4144 (ung)
Enzymes [BR:ppb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     PPUBIRD1_4144 (ung)
DNA repair and recombination proteins [BR:ppb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     PPUBIRD1_4144 (ung)
 Prokaryotic type
     PPUBIRD1_4144 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ADR61725
LinkDB All DBs
Position
complement(4630267..4630959)
Genome map
AA seq 230 aa AA seqDB search
MTDDDRIKLEPSWKAALRGEFDQPYMHQLREFLRGEYAAGKEIYPPGPLIFNALNSTPLG
QVKVVILGQDPYHGPGQAHGLCFSVQPGVATPPSLVNIYKELQRDLNIPIPSHGYLQSWA
EQGVLLLNTTMTVERANAASHAKKGWELFTDRIIQVVSEQCPNVVFLLWGAHAQSKQKLI
DGTKHLVLKSVHPSPLSAYRGFIGCGHFSRANSFLEQRGLGPIDWTLPPL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgacgatcgcatcaaactcgaacccagctggaaggccgcattgcgcggtgaa
ttcgaccagccttacatgcaccagctgcgcgagttcctgcgtggcgagtacgctgccggc
aaggagatctacccgccagggccgctgatcttcaatgcgctcaattcgacaccgctgggc
caggtgaaggtggtcatcctcggtcaggacccgtaccacgggccgggccaggcacatggc
ttgtgcttctcggtgcaaccgggcgtggccacgccgccgtcgctggtcaatatctacaag
gagctgcagcgcgacctgaacatcccgatccccagccacggctacctccaaagctgggca
gaacaaggcgttctgttgctcaacacgaccatgaccgtcgagcgcgccaatgccgcgtcg
catgccaagaaaggctgggaattgtttaccgacaggattatccaggtggtcagtgagcaa
tgcccgaacgtggtattcctgctatggggggcgcatgcacagagcaagcagaagctgatc
gacggtaccaagcatctggttttgaagtcggtccatccttcgccgctgtcggcgtatcgc
gggttcatcggttgcgggcatttcagccgtgccaacagcttcctcgagcagcgggggctc
gggcccatcgactggacactgcccccgctgtga

DBGET integrated database retrieval system