KEGG   Pseudopropionibacterium propionicum: HMPREF9154_1333
Entry
HMPREF9154_1333   CDS       T02180                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00620  Pyruvate metabolism
ppc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF9154_1333
Enzymes [BR:ppc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     HMPREF9154_1333
SSDB
Other DBs
NCBI-ProteinID: AFN47022
UniProt: I6Y097
LinkDB
Position
complement(1456859..1460236)
AA seq 1125 aa
MVDTAAIAAINLRLNLLGLRVPEAVDHSEGSDLVRPILARQRELDRRLSHRLPAVDGRVQ
AFLDSYLEGTGTSPKLPRQTFVLDQAGLARTLSLPVGADQFSSEYLSSYRLVNGVLHNPL
NDRRTTKGVFHVAEGGTAVQDDKLAVPREVYGRLLEHALNPPTDLMVLPYCAGDEAPAQA
WVSVLLRPVVVPHVPGFARERSLEVRFFAPGTLVANLDFVESIFGNGGDPYLPDNDASLK
PRGWTGHTGAVILAPHLTKLTKRELGLPHHDDATPRQRRDGMCWQDPEELYNGGSAFKVC
ARDERGVIVTVIADNYFGYCKKEVKAQISYSANLLGLVEEEHAGGAICFPRYNLGQQFTD
NYADPSYRLADIIARDPQRFVSQPEGHALDLENEHIVLVPERSTYSLRDQTVTWEVDGCR
GQIPLHADKAYVGPDGYLVRLHHLEADGAQWTLVGTAPRATHCHKPATVSGGGKSEISKA
ITDAVITGDAYVRDFDEDMAAVTRILDHDFSHRFADPARNGHDARPVLSDRRSVGSVIKL
LTPSRDYNDEYNAWLEAIPNHVKELVFVVKRFYRPEWGEDWASHFTVGIINGRKGSSLRL
DGEKIRVNMLRVGFAPDGSWRLFGLRHDFQPAAKVQTEDDITASIVVPPRPSGSELSRKF
VTNCEQLLFQRPDDAIHRGYDRQAEWDISQPGTFLSNFEPLSRQDAQALVDNAIEFSQFT
APVQELIRSFAASASPSPAWFVSSAHPRLVKGKPSKNPRYLQRRPDITKPESTAEAELAA
RLHRKLPMTQELRLPVDVVAAGRRNNAAEPGIPPLCAYSPLHYMELPELFMEFISSMTGK
SPSTTGAGSEGAMTKGPFNALPSVIDLNAAFLSFALTGYDGWLSSAGVVGPHVRVDHDIS
LLVPEVFSRMSDAERCAANLIEEGCLERVEDYEVDGKLILASRLGYRMTEKFASKYFGRI
FLHPHVVFTPEMLRPELQDPEMFAESVRTISATHARVAQTYFDDGTVALAVPPVRALLEI
MATGHTQDGLTLDDAPFRELFSRDSVLASGWYAERVSALREVELARLERSLGSIDAFTAN
ELHGPTAERLGLAARRASVESRIEELNQVPDLLWGTIGRQVTWRL
NT seq 3378 nt   +upstreamnt  +downstreamnt
atggtagacaccgcagcgatcgctgccatcaatctaagactgaatctgctggggctacgg
gttccggaggccgtcgaccactccgaggggtccgatctggtgcgcccgatactggcgcgg
cagcgcgaactggaccggcggctctcgcaccggcttcccgcggttgatggccgcgtccag
gcattcctggattcctacctggagggaaccggaacctccccgaagctgccccggcagacc
ttcgtgctggatcaggccggactggccaggacattgtcgcttcccgtcggggctgaccag
ttctcctcggaatacctgagcagttaccgcttggtcaacggggtgctgcacaatcccctg
aacgatcgccgcaccaccaagggtgtcttccatgtcgcagagggcggcacggcagtgcag
gatgacaaactggcggttccccgggaagtctacgggcgcctgctggagcacgccctgaac
ccgccgacggacttgatggtcctgccctactgcgcgggcgacgaggcccccgcccaggcg
tgggtgtccgtgctgctgcgtcccgtggtggttccccacgtcccgggtttcgcgcgggaa
cgcagcctggaggtgcgtttcttcgcgcctggcacgttggtggcgaaccttgacttcgtg
gagagcattttcggcaacgggggcgatccctacctgcctgacaacgacgcctccctgaaa
ccccggggttggacgggacacacgggcgcggtgatcctggccccgcacctgacgaaactg
accaaacgggaactcggcctcccccaccacgacgacgcgacgccgcgccagcgccgcgac
ggtatgtgctggcaggacccggaggaactctacaacggtggaagcgcgttcaaggtgtgc
gcccgcgacgaacgcggggtgattgtcaccgtgatcgcggacaattacttcgggtactgc
aagaaggaagtcaaggcccagatcagctactccgccaacctgctgggcctggttgaggag
gaacacgccggcggcgccatctgcttcccccgctacaacctgggccagcagttcaccgac
aactacgccgatcccagttaccggctggccgacatcatcgcccgcgacccgcagcgtttc
gtctcccagcccgaaggtcacgccttggacctggagaacgagcacatcgtcctggtcccc
gaacgctccacatacagcctgcgtgaccagaccgtcacctgggaggtagacggctgcagg
ggccagatcccgctgcacgccgacaaggcatacgtcgggccggatggttatctcgtgcgg
ctgcaccacctggaggccgacggtgcccagtggaccctggtcggaaccgccccgagggcc
acccactgccacaagcccgccacggtctcgggaggcggcaagtccgagatctccaaggcc
atcaccgacgccgtgatcaccggcgacgcctacgtccgggatttcgacgaggacatggcg
gcggtcacccggatcctggaccacgacttcagccaccgcttcgcggatcccgcccggaac
ggccacgacgcccggcccgtgctttccgaccggcgttccgtgggttcggtgatcaagctg
ctgaccccgagccgcgactacaacgacgagtacaacgcgtggctggaggcgatccccaac
cacgtcaaggaactcgtgtttgtggtgaaacggttctaccgtccggaatggggcgaggac
tgggccagccatttcactgtcggcatcatcaacgggcgaaaaggaagctcgctgcgcctc
gacggggagaagatccgcgtgaacatgctgcgggtgggatttgcccctgacggttcgtgg
cggctgttcgggctgcgccacgacttccagcccgcagcgaaggtgcagaccgaggacgac
atcactgccagcatcgtcgtgcccccccgcccctcgggcagcgagctctcccggaagttc
gtcaccaactgcgaacagctgctgttccagcgccccgacgatgccatccaccgcggctac
gacagacaggcggagtgggacatctcccagcccgggactttcctgtccaatttcgagccg
ctctcacgccaggacgcccaagcgctggtggacaacgcgatcgagttcagccagttcacg
gcccccgtgcaggaactgatccgctccttcgctgcctcggcctccccctcacccgcatgg
ttcgtgagctcggcccatccgcgcctggtcaagggcaaaccatccaagaacccccgctat
ctgcagcgccgccccgacatcaccaaaccggagagcaccgcggaagcggagctggccgcc
cggctgcaccgcaagctgccgatgacccaggagttgcgcctgccggtggacgtggtggcc
gcgggccgtaggaacaacgccgccgagcccggtatcccaccgctttgcgcctactccccc
ctgcactacatggagctcccggaactgttcatggagttcatcagctccatgaccggcaag
tctccttccacgacgggagctggttccgagggggccatgaccaagggccccttcaacgct
cttccttcggtcatcgacctgaacgccgccttcctgtccttcgcgctgaccggttacgac
gggtggctgtccagcgccggggtggtgggtccgcacgtccgggtcgatcacgacatcagc
cttctggttcccgaggtcttttcccgaatgtccgacgccgaacgctgcgcggcgaacctg
atcgaggagggctgcctggaacgcgtcgaggactacgaggtggacggcaagctgatcctc
gcctcccggctcgggtaccgcatgaccgagaagttcgcatccaagtacttcggacggatc
ttcctgcacccccatgtggtcttcacccccgagatgctgcgccccgagctgcaggatccg
gagatgttcgccgaatcggtgcgcacaatctcagccactcacgcccgggtcgcgcagacg
tatttcgacgacggcaccgtggccctggcggtccccccggtgcgtgcacttctcgagatc
atggccaccggtcacacccaggatggcctgaccctggacgacgccccgttccgagaactg
ttcagccgtgattccgtgctggcttccggatggtacgcggaacgcgtttccgcgctccgc
gaggtggagctggcccgtctggaacgctcgctgggttccatcgacgccttcaccgccaat
gagctgcacggcccgaccgccgaacgtctcggcctcgcggcgcggcgcgcctcggtggag
tcgcggatcgaagagctgaatcaggttcccgacctgctctggggaacgatcggacggcaa
gtcacttggcggctgtga

DBGET integrated database retrieval system