KEGG   Pseudopropionibacterium propionicum: HMPREF9154_1400Help
Entry
HMPREF9154_1400   CDS       T02180                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00020  Citrate cycle (TCA cycle)
ppc00310  Lysine degradation
ppc00380  Tryptophan metabolism
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
ppc01120  Microbial metabolism in diverse environments
ppc01130  Biosynthesis of antibiotics
ppc01200  Carbon metabolism
Module
ppc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF9154_1400 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    HMPREF9154_1400 (sucA)
   00380 Tryptophan metabolism
    HMPREF9154_1400 (sucA)
Enzymes [BR:ppc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     HMPREF9154_1400 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AFN46157
UniProt: I6XY29
LinkDB All DBs
Position
complement(1524920..1528645)
Genome map
AA seq 1241 aa AA seqDB search
MWQRPLAKMSTPDSHDAFGANSWLIDEMRDAWEKDPSSVDESWQAFFKDKPIPTNTAPTP
TPPARDDRPTPPPQERTPRQEGNQPMVESVKPTRESPSTPGTGAGLSANAPNPSLRPEPS
AVAPRLTVLRGAPMRTAKNMDASLSVPTATSVRSVPMKLVIDQRTGINNFLKTSKGGKVS
FTHLIAYAMIQALKAVPAMNNSYDVINGKPTLIENPAINLGIAIDLKKPDGTRQLLVPNI
KGCEKLNFAQFWADYEKIIAKARAGELTVADFAGTTATITNPGGIGTNHSVPRLMNGQGM
ILGVGNIDYPAEFQGTSLFHVDDFGISKITTLTSTYDHRVIQGAQSGEFLKIIHQLLLGE
QGFYDKIFEALRIPYEPLRWSVDISTHRENQVAKQGRVLELINAYRSVGHLVADTDPLEY
RQRSHEDLRLETHGLSIWDLDREFAVGSFGGQERVYRSLREILAILQDSYCRTVAVEYMH
IADPQQRKWFQDRIEVPHQALTHQEHMHALDKLNEAEVFETFLQTKFVGQKRFSLEGGES
VIVLLDEICQQAANEQLDEVCIGMPHRGRLNVMSNIVGKDYAQIFHEFAGTIDVSGTGDV
KYHLGSEGKFVANNGATIKASVAANPSHLEAVNPVLQGIARAKQDMVGGDDFPVLPLLLH
GDAAFCGQGVIFETLQMSQLRGYKTGGTIHIVVNNQVGFTTAPIESRTSTYCTDVAKAIS
APVLHINGDDPDSCIRAARLAFTYRQQFHKDVVIDLVCYRRRGHNEGDDPSFTQPKMYDL
IEQKRSVRRLYTEALIGRGDISMSDAEDVMDKFRARLENVFKEARDAKNTDAVIEEYTRV
PYYPTKQGHRLTEITPEMLHRISEVHTRLPEGFTPHPKVLPQLKRRADQILNGPIDWATA
ELLAIGSLLMEGRPVRLTGQDSRRGTFSQRFAAIVDRVTNEAWVPLKHLSDDQATFDVYD
SLLSEYAAMGFEYGYSVARPDALVLWEAQFGDFANGAQIIADEFVVSGQAKWDQKSGVVL
LLPHGFEGQGPDHSSARIERWLQLCAENALAVSQPSTAASYFHLLRQHAYVNYHRPVVVA
TPKSMLRSKAAASLPEEFTSGAWHPVLDDPTITDPSEVTRLLICSGKIRWELVTSREKFG
LDGKVAIISLERLYPLPGAEMAKVLERYRHVTDIRFVQDEPANQGPWPFISVHLPNSVAN
HTDIPLRMHRVARPWSSAPSVGSMKVHQQQTTDLMNSAFGA
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
ttgtggcagcggccactggcgaagatgtcgacacctgactcacacgatgcatttggagca
aactcctggttgatcgacgagatgcgggatgcctgggaaaaggatccctcatccgtggac
gaatcgtggcaggccttcttcaaggacaagcccatccccacgaacacggcccccacaccc
actcccccagcgcgggatgatcgtcccacccctcccccgcaggagcgcactccccggcag
gagggaaaccaaccgatggtggaatcggtcaaacccaccagggaatccccctccaccccg
ggcaccggggccggcctgtcggccaacgcaccgaacccgtcgctgcgacccgagccctcc
gcggtggcaccccgcctgaccgtacttcgcggcgccccgatgcgcacggccaagaacatg
gacgcctcactgagcgtgcccaccgccacatccgtgcgttccgtgcccatgaaactcgtg
atcgatcagcgcaccgggatcaacaacttcctgaaaacctccaagggcggcaaggtcagc
ttcacccatctgatcgcctacgcgatgatccaggccctgaaggccgtgcccgcgatgaac
aattcctacgacgtcatcaacggcaagccgacgctgatcgaaaaccccgcgatcaacctg
ggaatcgccatcgacctcaagaaaccggatggcacccgccagctcttggttcccaacatc
aagggatgcgaaaagctcaatttcgcgcagttctgggcagactacgaaaagatcatcgcc
aaggcgcgcgccggggagctcacggtggccgatttcgccggtaccaccgccaccatcacc
aatcccgggggcatcgggacgaatcactccgtgccccggctgatgaacggtcagggaatg
atcctcggtgtcgggaacatcgactatcccgcggagttccaggggacctcgctgttccac
gtcgacgacttcggcatctccaagatcacgacgctcacctccacctatgaccaccgcgtg
atccagggtgcccagtcgggcgagttcctgaagatcatccaccagctgctgctcggggag
cagggcttctacgacaagatcttcgaggccctgcgtatcccgtacgagccgttgcgctgg
agtgtcgacatctccacccaccgcgagaaccaggttgcgaagcagggacgggtgctggaa
ctcatcaacgcctaccgctcggtgggacacctggtggccgacaccgacccgctggagtac
cggcaacgctcacacgaggacctgcggctggaaacccacggcctgtccatctgggatctg
gaccgtgagttcgccgttggctccttcggcggacaggaaagggtctaccgctcgctgcgg
gagatcctcgcaatcctgcaggactcctactgccgcaccgtggccgtcgagtacatgcac
atcgcggatccccagcagcgcaagtggttccaggaccgcatcgaggtgccccaccaggcc
ctaacccaccaggagcacatgcacgccctcgacaaactgaacgaggccgaggtcttcgaa
accttcctgcagaccaagttcgtcggacagaaacgtttctccctggagggcggtgaatcc
gttatcgtcctgctggacgagatctgccagcaggccgcgaacgaacaactcgacgaggtg
tgcataggtatgccgcaccgcggccgcctgaacgtgatgtcgaacatcgtcggcaaggac
tacgcccagatcttccacgagttcgcaggcaccatcgacgtctccggcaccggtgacgtc
aagtaccacctgggttcggagggcaagttcgtcgccaacaacggggccaccatcaaggcc
tccgtcgcggccaatccatcccatctggaagcggtcaacccggttctccaaggaatcgcc
cgggcgaaacaggacatggtcggtggcgacgacttcccggtgctgccgcttctcctgcac
ggcgatgcggccttctgcggccagggggtcatcttcgaaaccctgcagatgagccagctg
cgcggctacaagaccggcggcaccatccacatcgtggtcaacaaccaggtgggattcacc
acggcccccatcgagtcgcgcacctccacctactgcacggacgtcgccaaggccatctcc
gccccggtgctgcacatcaacggcgacgaccccgattcctgcattcgggccgcccggctg
gccttcacctaccgacagcagttccacaaggatgtcgtgatcgacctggtctgctaccgg
cgccgcggccacaacgaaggcgacgacccgagcttcacgcagcccaagatgtacgacctg
atcgagcagaaacgctccgtcaggcgcctgtacaccgaggccctgatcggacgcggagac
atttccatgtccgacgccgaggacgtgatggacaagttcagggcccgcctggagaacgtg
ttcaaggaggcccgtgatgccaagaacaccgacgcggtgatcgaggagtacacgagggtg
ccctactatccgacgaagcaggggcaccggctcaccgagatcacaccggagatgctgcac
cgaatcagcgaggtgcacaccaggctcccggagggtttcaccccccatccgaaggtgttg
ccccagctgaaacgccgtgccgatcagattctcaacggccccatcgactgggcgacggcc
gagctgctcgccatcggttcgttgctgatggaggggcggcccgtccggctgaccgggcag
gattcgcgccgcgggaccttctcgcaacggttcgcggccatcgtcgaccgcgtcaccaac
gaggcctgggtgcccctgaaacacctgagcgacgaccaggccaccttcgatgtctacgac
tcgctgctcagcgagtacgctgccatgggtttcgagtacggctactccgtggcccggccg
gacgccctggtgttgtgggaggcgcagttcggagacttcgccaacggcgcccagatcatc
gccgacgagttcgtcgtgtccgggcaggcgaagtgggaccagaagtccggtgtggtgctg
ctgctgccgcacggcttcgaggggcagggcccggaccacagctccgcacgcatcgaacgc
tggctgcagctgtgcgccgagaacgccctcgccgtcagccagccgtcgacggcagcaagc
tatttccacctgctgcgccagcacgcctacgtgaactaccaccgtccggtcgtggtggcc
accccgaaatcgatgctgcgcagcaaggcggctgcctcgctgccggaggagttcacctcg
ggggcctggcatccggtgctggacgacccgacgatcacggatccgtccgaggtcacccgc
ctgctgatctgttccggcaagatccgctgggagctcgtgaccagccgggagaagttcggt
ctcgacggcaaagtggcaatcatctccttggagcgcctctatccgctgcccggagccgag
atggccaaggtgctggaacgctaccgtcacgtcaccgacatccggttcgtccaggacgag
cccgccaaccaggggccgtggccgttcatctctgtgcacctgccgaattccgtggctaac
cacaccgacatcccgctgcgcatgcaccgggtggcacgaccatggtcctccgccccgtcg
gtcggttccatgaaggttcaccagcagcagaccacggatctgatgaacagcgctttcggg
gcgtga

DBGET integrated database retrieval system